Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9firm-q3ger7

Syntrophomonas wolfei subsp. wolfei str. Goettingen esterase

Comment
PfamA Peptidase_S9 643 855 Other strains: Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)


Relationship
Family|Prolyl_oligopeptidase_S9
Block| X
Position in NCBI Life Tree|Syntrophomonas wolfei subsp. wolfei str. Goettingen
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > Syntrophomonadaceae: N E > Syntrophomonas: N E > Syntrophomonas wolfei: N E > Syntrophomonas wolfei subsp. wolfei: N E > Syntrophomonas wolfei subsp. wolfei str. Goettingen G311: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AAJG01000002, WP_011641869, ABI69787
1 UniProt : Q0AU17
1 Interpro : Q0AU17
1 Pfam : Q0AU17
1 PIRSF : Q0AU17
1 SUPERFAM : Q0AU17
Sequence
Graphical view for this peptide sequence: 9firm-q3ger7
Colored MSA for Prolyl_oligopeptidase_S9 (raw)
YILYREGPEKPWKRLIEFDLSLTRDYEIIGFSADNTKMIVKTNFYDNYAS
LYQVDPETMSRELIYHNSHADVAVELVSVLAGTPVVSLKNPETGELLTAI
YIDDKTRLVCLRDEMATIMDNVRADLGENQFPVAISPDFDYLVLLHRDDR
DYGSYRLYNVESRKDTLLLSSDIPIKDVGHSYPVSFKASDGHTVFGYLTL
PPGKSPRNLPLIVNVHGGPQARYVWTPNEYALLASNLDIGVLSVDFRFSI
GYGNEYSDSASKNMPLAQQDVFESVNWAINNGIADPECIGIMGHSYGGYI
SFYQAAVHPDVYKAVISLMGVWDWTDLGLELIQDDPVPDYHRCSAPEPYT
ELAQVLSPSSYADKLKSPILIIYAGQDDAVYPSQNIRAIKELTEAGNTPQ
VLYLPDSGHTPDTLENITAVFEEIKSFLDEQMKANPWIISRRNASEN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

YILYREGPEKPWKRLIEFDLSLTRDYEIIGFSADNTKMIVKTNFYDNYAS
LYQVDPETMSRELIYHNSHADVAVELVSVLAGTPVVSLKNPETGELLTAI
YIDDKTRLVCLRDEMATIMDNVRADLGENQFPVAISPDFDYLVLLHRDDR
DYGSYRLYNVESRKDTLLLSSDIPIKDVGHSYPVSFKASDGHTVFGYLTL
PPGKSPRNLPLIVNVHGGPQARYVWTPNEYALLASNLDIGVLSVDFRFSI
GYGNEYSDSASKNMPLAQQDVFESVNWAINNGIADPECIGIMGHSYGGYI
SFYQAAVHPDVYKAVISLMGVWDWTDLGLELIQDDPVPDYHRCSAPEPYT
ELAQVLSPSSYADKLKSPILIIYAGQDDAVYPSQNIRAIKELTEAGNTPQ
VLYLPDSGHTPDTLENITAVFEEIKSFLDEQMKANPWIISRRNASEN



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer