Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9flao-a0a330mq60

Aequorivita sp. CIP111184 Poly(Ethylene terephthalate) hydrolase PET27

Comment
c-term 299 360 Por_Secre_tail excluded here


Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|Aequorivita sp. CIP111184
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Flavobacteriaceae: N E > Aequorivita: N E > unclassified Aequorivita: N E


Molecular evidence
Database
2 Genbank : SRX55697, WP_111881932
1 UniProt : A0A330MQ60
1 UniProt : A0A330MQ60
1 Interpro : A0A330MQ60
1 Prodom : A0A330MQ60
1 Pfam : A0A330MQ60
1 PIRSF : A0A330MQ60
1 SUPERFAM : A0A330MQ60
Sequence
Graphical view for this peptide sequence: 9flao-a0a330mq60
Colored MSA for Polyesterase-lipase-cutinase (raw)
MKKIYAVALFFLATSFAPNIIFAQCGDVTIESLTNPGPYEVATLTEADGL
RNGPDYQGATVYYPTNATPPFASIAIVPGFTALPSSVEEWGPFYASHGIV
TIIIGTNSLFDFPEERAVALIDALETMRQENTRSSSPLENQLDVDKFAVS
GWSMGGGGAQRAAVLDNTIKGVVALCPWLPNASLNHDSPVLIFSGENDPT
APPAQHADLHYAATPNTTNKLLFEIENGNHSVANTPNGGNGAVGKIALSW
LKLYVDENDCYCPLLTESLLVDPPAASKVLSSFECELLSVPDNSFAISV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKIYAVALFFLATSFAPNIIFAQCGDVTIESLTNPGPYEVATLTEADGL
RNGPDYQGATVYYPTNATPPFASIAIVPGFTALPSSVEEWGPFYASHGIV
TIIIGTNSLFDFPEERAVALIDALETMRQENTRSSSPLENQLDVDKFAVS
GWSMGGGGAQRAAVLDNTIKGVVALCPWLPNASLNHDSPVLIFSGENDPT
APPAQHADLHYAATPNTTNKLLFEIENGNHSVANTPNGGNGAVGKIALSW
LKLYVDENDCYCPLLTESLLVDPPAASKVLSSFECELLSVPDNSFAISV


References
    Title: The Bacteroidetes Aequorivita sp. and Kaistella jeonii Produce Promiscuous Esterases With PET-Hydrolyzing Activity
    Zhang H, Perez-Garcia P, Dierkes RF, Applegate V, Schumacher J, Chibani CM, Sternagel S, Preuss L, Weigert S and Streit WR <9 more author(s)>
    Ref: Front Microbiol, 12:803896, 2021 : PubMed

            

    Title: The abundance of mRNA transcripts of bacteroidetal polyethylene terephthalate (PET) esterase genes may indicate a role in marine plastic degradation
    Zhang H, Dierkes R, Perez-Garcia P, Weigert S, Sternagel S, Hallam S, Schott T, Juergens K, Vollstedt C and Streit WR <8 more author(s)>
    Ref: ResearchSquare, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer