Gene_locus Report for: 9flao-q1vqu4Psychroflexus torquis (strain ATCC 700755 / ACAM 623) homoserine o-acetyltransferase metXA Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Flavobacteriaceae: N E > Psychroflexus: N E > Psychroflexus torquis: N E > Psychroflexus torquis ATCC 700755: N E
6_AlphaBeta_hydrolase : 9flao-q1vq34Psychroflexus torquis (strain ATCC 700755 / ACAM 623) hydrolase, alpha/beta hydrolase fold family protein, 9flao-q1vta1Psychroflexus torquis (strain ATCC 700755 / ACAM 623) dihydrolipoamide acetyltransferase, psytt-k4iqj6Psychroflexus torquis (strain ATCC 700755 / ACAM 623) 3-oxoadipate enol-lactonase, 9flao-q1vwk7Psychroflexus torquis (strain ATCC 700755 / ACAM 623) hypothetical protein, 9flao-q1vxv3Psychroflexus torquis (strain ATCC 700755 / ACAM 623) 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase MenH menaquinone biosynthesis related protein. A85-Feruloyl-Esterase : 9flao-q1vu92Psychroflexus torquis (strain ATCC 700755 / ACAM 623) hypothetical protein. A85-IroE-IroD-Fes-Yiel : 9flao-q1vs12Psychroflexus torquis (strain ATCC 700755 / ACAM 623) putative esterase, 9flao-q1vsw5Psychroflexus torquis (strain ATCC 700755 / ACAM 623) predicted hydrolase of the alpha/beta superfamily protein. ABHD11-Acetyl_transferase : 9flao-q1vuh7Psychroflexus torquis (strain ATCC 700755 / ACAM 623) Acyl-CoA esterase, alpha/beta hydrolase family. ACPH_Peptidase_S9 : 9flao-q1vuy0Psychroflexus torquis (strain ATCC 700755 / ACAM 623) acylaminoacyl-peptidase. Acyl-CoA_Thioesterase : 9flao-q1vpk2Psychroflexus torquis (strain ATCC 700755 / ACAM 623) hypothetical protein. Carbon-carbon_bond_hydrolase : 9flao-q1vwe4Psychroflexus torquis (strain ATCC 700755 / ACAM 623) beta-d-galactosidase, putative. Carboxypeptidase_S10 : 9flao-q1vtz3Psychroflexus torquis (strain ATCC 700755 / ACAM 623) hypothetical protein. Cocaine_esterase : 9flao-q1vns5Psychroflexus torquis ATCC 700755 x-pro dipeptidyl-peptidase family protein (fragment), 9flao-q1vt96Psychroflexus torquis (strain ATCC 700755 / ACAM 623) Acyl esterase, CocE/NonD family, 9flao-q1w055Psychroflexus torquis (strain ATCC 700755 / ACAM 623) glutaryl-7-aca acylase. Dienelactone_hydrolase : 9flao-q1vvp0Psychroflexus torquis (strain ATCC 700755 / ACAM 623) dienelactone hydrolase and related enzyme. DPP4N_Peptidase_S9 : 9flao-q1vin2Psychroflexus torquis ATCC 700755 putative dipeptidyl peptidase (fragment), 9flao-q1vpg2Psychroflexus torquis (strain ATCC 700755 / ACAM 623) dipeptidyl aminopeptidase IV, 9flao-q1vrv6Psychroflexus torquis (strain ATCC 700755 / ACAM 623) dipeptidyl-peptidase, 9flao-q1vsl7Psychroflexus torquis (strain ATCC 700755 / ACAM 623) dipeptidyl aminopeptidase. Epoxide_hydrolase : 9flao-q1vyh1Psychroflexus torquis (strain ATCC 700755 / ACAM 623) alpha/beta hydrolase fold protein, psytt-k4iv88Psychroflexus torquis (strain ATCC 700755 / ACAM 623) beta-ketoadipate enol-lactone hydrolase, putative. Haloperoxidase : 9flao-q1w0m2Psychroflexus torquis (strain ATCC 700755 / ACAM 623) Non-heme haloperoxidase, putative. LYsophospholipase_carboxylesterase : 9flao-q1viu7Psychroflexus torquis ATCC 700755 phospholipase/carboxylesterase family protein (fragment), 9flao-q1vsa7Psychroflexus torquis (strain ATCC 700755 / ACAM 623) phospholipase/carboxylesterase family protein, 9flao-q1vx71Psychroflexus torquis (strain ATCC 700755 / ACAM 623) esterase/lipase, putative. PolyAspartate-hydrolase : 9flao-q1vqh8Psychroflexus torquis (strain ATCC 700755 / ACAM 623) Putative uncharacterized protein. Proline_iminopeptidase : 9flao-q1vr63Psychroflexus torquis (strain ATCC 700755 / ACAM 623) prolyl aminopeptidase, 9flao-q1vri9Psychroflexus torquis(strain ATCC 700755 / ACAM 623) proline iminopeptidase. Prolyl_oligopeptidase_S9 : 9flao-q1vt84Psychroflexus torquis (strain ATCC 700755 / ACAM 623) prolyl oligopeptidase family protein. S9N_PPCE_Peptidase_S9 : 9flao-q1vxy2Psychroflexus torquis (strain ATCC 700755 / ACAM 623) prolyl endopeptidase, 9flao-q1vz51Psychroflexus torquis (strain ATCC 700755 / ACAM 623) prolyl oligopeptidase family protein. S9N_PREPL_Peptidase_S9 : 9flao-q1vth4Psychroflexus torquis (strain ATCC 700755 / ACAM 623) putative peptidase, 9flao-q1w0e6Psychroflexus torquis (strain ATCC 700755 / ACAM 623) peptidase s9, prolyl oligopeptidase active site region
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9flao-q1vqu4
Colored MSA for Homoserine_transacetylase (raw)
MPEIFKYQDPFQLENGEVLPELEVSYSTLGKLNKEKSNVIWVCHALTANA
QPEDWWRGLIGNEKGIDTEKYFIVCANIIGSCYGSTNPKSINPETGEVYG
LNFPLFSIRDVTKSLELLSEALEIEHIQFLIGGSMGGMQAMEWAIEKPDK
IKNLILLATNAKHSSWGIALNETQRMAIEADSTFYKKETNSGKKGLEAAR
AIALLSYRNYNTYRHTQVDQEHTADHFRASTYQKYQGEKLSKRFNAKCYW
YLSKAMDSHNVGRNRGDCKKALAKIKAETLVIAVQSDLLFPVEEQRFLAQ
YIPKGKLEIIDSIYGHDGFLIEVEKIKSLVHKHFKL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MPEIFKYQDPFQLENGEVLPELEVSYSTLGKLNKEKSNVIWVCHALTANA
QPEDWWRGLIGNEKGIDTEKYFIVCANIIGSCYGSTNPKSINPETGEVYG
LNFPLFSIRDVTKSLELLSEALEIEHIQFLIGGSMGGMQAMEWAIEKPDK
IKNLILLATNAKHSSWGIALNETQRMAIEADSTFYKKETNSGKKGLEAAR
AIALLSYRNYNTYRHTQVDQEHTADHFRASTYQKYQGEKLSKRFNAKCYW
YLSKAMDSHNVGRNRGDCKKALAKIKAETLVIAVQSDLLFPVEEQRFLAQ
YIPKGKLEIIDSIYGHDGFLIEVEKIKSLVHKHFKL
|
|
|
|
