Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9flao-q1vwe4

Psychroflexus torquis (strain ATCC 700755 / ACAM 623) beta-d-galactosidase, putative

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Psychroflexus torquis ATCC 700755
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Flavobacteriaceae: N E > Psychroflexus: N E > Psychroflexus torquis: N E > Psychroflexus torquis ATCC 700755: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AFU69814
1 UniProt : K4IHG5
1 UniProt : K4IHG5
1 Interpro : K4IHG5
1 Prodom : K4IHG5
1 Pfam : K4IHG5
1 PIRSF : K4IHG5
1 SUPERFAM : K4IHG5
Sequence
Graphical view for this peptide sequence: 9flao-q1vwe4
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MNFEILKNLMEEHIKQEGKFKYFEKGEGTPIVVLHGLMGGLSNFDGVMNY
FPTKGYKVVVPELPLYDMPLLKTNTKNLANYIKEFIDFKNYGKVILVGNS
LGGHVGLLTTKYFPESVKALVITGSSGLYESAMGESYPKRGDYEYMKKKV
QDVFYDPEIATPEIIDDVYSVVNDRNKLIRTLSIAKSAIRHNMSKDLPDM
HTPTCIIWGEQDEVTPPEVAVDFNKLLPDSELFWIDKCGHAAMMERPDEF
NKILYAWLQKRNF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNFEILKNLMEEHIKQEGKFKYFEKGEGTPIVVLHGLMGGLSNFDGVMNY
FPTKGYKVVVPELPLYDMPLLKTNTKNLANYIKEFIDFKNYGKVILVGNS
LGGHVGLLTTKYFPESVKALVITGSSGLYESAMGESYPKRGDYEYMKKKV
QDVFYDPEIATPEIIDDVYSVVNDRNKLIRTLSIAKSAIRHNMSKDLPDM
HTPTCIIWGEQDEVTPPEVAVDFNKLLPDSELFWIDKCGHAAMMERPDEF
NKILYAWLQKRNF



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer