Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-BioJ

Francisella philomiragia BioJ pimeloyl-ACP methyl ester esterase

Comment
The FTN_0818 gene required for Francisella virulence is involved in biotin metabolism. This protein named BioJ is the enzyme of the biotin biosynthesis pathway that determines the chain length of the biotin valeryl side-chain. It is the functionnal equivalent of BioH although it shows low homology to BioH. Other strains: Francisella philomiragia subsp. philomiragia ATCC 25015; Francisella noatunensis; Francisella sp. TX077308


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Francisella philomiragia subsp. philomiragia ATCC 25015
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Thiotrichales: N E > Francisellaceae: N E > Francisella: N E > Francisella philomiragia: N E > Francisella philomiragia subsp. philomiragia ATCC 25015: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6K1T: Crystal structure of Francisella philomiragia BioJ
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: WP_004287811, AJI74530, WP_042523240
1 UniProt : C6YW90
1 Structure : 6K1T
1 UniProt : C6YW90
1 Interpro : C6YW90
1 Prodom : C6YW90
1 Pfam : C6YW90
1 PIRSF : C6YW90
1 SUPERFAM : C6YW90
Sequence
Graphical view for this peptide sequence: 9gamm-BioJ
Colored MSA for Hormone-sensitive_lipase_like (raw)
MPYHPALESLLDTPEIRKIKKLDLRDQRKIFADLSIAQIKRLPRPDIIEE
DIKLENDTILRHYKPKKASDKAVLFIHGGGWCLSSIDTYDHVCRYLCDQG
NLNIFSLEYGLGPEDKYPAAVNHALYAYDWLYENITKFNLSTENIFVMGD
SAGGNLVTIICHERQENMPKAQILVYPAVDMYTKYDSNTKFDEYKYHLTT
EWCELFLKAYIGEDIMSEPKKLRQPTISPLFYKDTKQPDTLIVAATHDIL
IDGIYAYEEKLKQQGTYVETHYDDEMYHGFIGGLGVVPFENPKIALDKII
EFINKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPYHPALESLLDTPEIRKIKKLDLRDQRKIFADLSIAQIKRLPRPDIIEE
DIKLENDTILRHYKPKKASDKAVLFIHGGGWCLSSIDTYDHVCRYLCDQG
NLNIFSLEYGLGPEDKYPAAVNHALYAYDWLYENITKFNLSTENIFVMGD
SAGGNLVTIICHERQENMPKAQILVYPAVDMYTKYDSNTKFDEYKYHLTT
EWCELFLKAYIGEDIMSEPKKLRQPTISPLFYKDTKQPDTLIVAATHDIL
IDGIYAYEEKLKQQGTYVETHYDDEMYHGFIGGLGVVPFENPKIALDKII
EFINKR


References
1 more
    Title: Molecular Basis of BioJ, a Unique Gatekeeper in Bacterial Biotin Synthesis
    Wei W, Guan H, Zhu T, Zhang S, Fan C, Ouyang S, Feng Y
    Ref: iScience, 19:796, 2019 : PubMed

            

    Title: A Biotin Biosynthesis Gene Restricted to Helicobacter
    Bi H, Zhu L, Jia J, Cronan JE
    Ref: Sci Rep, 6:21162, 2016 : PubMed

            

    Title: A Francisella virulence factor catalyses an essential reaction of biotin synthesis
    Feng Y, Napier BA, Manandhar M, Henke SK, Weiss DS, Cronan JE
    Ref: Molecular Microbiology, 91:300, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer