Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-a0a010jxi9

Acinetobacter sp.; Acinetobacter nosocomialis Alpha/beta hydrolase fold family protein

Comment
Other strains: Acinetobacter sp.; Acinetobacter nosocomialis NIPH 386


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Acinetobacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9gamm-a0a010jxi9
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTTREQTTYVLSEEMQSLVYWSSIYSPADADIDSIRAAYEAMCRHYTLPR
DGKIEVEDRVVANAGHPVPVRVYLPKTNRPKAGWPCVLYLHGGGWMVGGL
DSHEFITSYLCQDLNAIVIGVDYRLAPEHHFPAAFEDCLAVYQWLKQHGS
AWQIDSENIVLAGDSAGGNLAAALAVDLQHSGLQAQGLALVYPCLTTAFD
TPAVQKHAHAPLLTAEDMHFYLKEYAPNSQEWQDLRLAPLLATDFSDMPT
SFVAVAEYDPLSDDGYLFTQKLEQAGIPNEFHLGKGLLHGSLRLMRDCPE
VQHLYQNMLSAIRRMLSSAEKTSI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTREQTTYVLSEEMQSLVYWSSIYSPADADIDSIRAAYEAMCRHYTLPR
DGKIEVEDRVVANAGHPVPVRVYLPKTNRPKAGWPCVLYLHGGGWMVGGL
DSHEFITSYLCQDLNAIVIGVDYRLAPEHHFPAAFEDCLAVYQWLKQHGS
AWQIDSENIVLAGDSAGGNLAAALAVDLQHSGLQAQGLALVYPCLTTAFD
TPAVQKHAHAPLLTAEDMHFYLKEYAPNSQEWQDLRLAPLLATDFSDMPT
SFVAVAEYDPLSDDGYLFTQKLEQAGIPNEFHLGKGLLHGSLRLMRDCPE
VQHLYQNMLSAIRRMLSSAEKTSI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer