Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-a0a022j7u6

Acinetobacter sp. (Acinetobacter genomosp. 3); Acinetobacter pittii Alpha/beta hydrolase fold family protein

Comment
Other strains: Acinetobacter sp. (Acinetobacter genomosp. 3); Acinetobacter pittii


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Acinetobacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_002120287
2 UniProt : A0A022J7U6, K9C944
2 Interpro : A0A022J7U6, K9C944
2 Prodom : A0A022J7U6, K9C944
2 Pfam : A0A022J7U6, K9C944
2 PIRSF : A0A022J7U6, K9C944
2 SUPERFAM : A0A022J7U6, K9C944
Sequence
Graphical view for this peptide sequence: 9gamm-a0a022j7u6
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTTCEQTTYVLSEEMQSLVYWSSIYSPADADIDSVRAAYDAMCRHYTLPR
DGKIEVEDRVVANAEHPLPVRMYSPKTKRPEAGWPCVLYLHGGGWMVGGL
DSHEFITSYLCQDLNAVVIGVDYRMAPEHRFPAAFEDCLAVYQWLKQHSS
DWQIDSENIVLAGDSAGGNLAAALAVHLQHSGLQAQGLALVYPCLTTALD
TPAAQKHAHAPLLTTEDMHFYLKEYAPNSQDWQDVRLAPLLAMDFSDMPA
SFVAVAEYDPLSDDGYFLTQKLEQVGIPTEFHLGKGLLHGSLRLMRDCPE
VQHLYQNMLSAIRRMFGSVEKISI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTCEQTTYVLSEEMQSLVYWSSIYSPADADIDSVRAAYDAMCRHYTLPR
DGKIEVEDRVVANAEHPLPVRMYSPKTKRPEAGWPCVLYLHGGGWMVGGL
DSHEFITSYLCQDLNAVVIGVDYRMAPEHRFPAAFEDCLAVYQWLKQHSS
DWQIDSENIVLAGDSAGGNLAAALAVHLQHSGLQAQGLALVYPCLTTALD
TPAAQKHAHAPLLTTEDMHFYLKEYAPNSQDWQDVRLAPLLAMDFSDMPA
SFVAVAEYDPLSDDGYFLTQKLEQVGIPTEFHLGKGLLHGSLRLMRDCPE
VQHLYQNMLSAIRRMFGSVEKISI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer