Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-a0a1e4kb00

Xanthomonadaceae bacterium SCN 69-320. Uncharacterized protein

Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Xanthomonadaceae bacterium SCN 69-320
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > unclassified Xanthomonadaceae: N E > unclassified Xanthomonadaceae (miscellaneous): N E > Xanthomonadaceae bacterium SCN 69-320: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : MEFP01000001
1 UniProt : A0A1E4KB00
1 UniProt : A0A1E4KB00
1 Interpro : A0A1E4KB00
1 Pfam : A0A1E4KB00
1 PIRSF : A0A1E4KB00
1 SUPERFAM : A0A1E4KB00
Sequence
Graphical view for this peptide sequence: 9gamm-a0a1e4kb00
Colored MSA for VirJ (raw)
MRNLIVLLLTALTVDAAAATSPVHYGLFGELHLARPAQTAAQTVLFMSDA
NGWDAREDAYADALAAAGNLVVGIDLPSYLKQLESIKSDCAYPAAHVEEV
SHWIQRHENLVNYSAPWLIGLDRGASLAYAVAAQAPAGTFDGLVTLGFDF
AFRLRKPLCPGDAGKATVADGKRGFRVVPVPRLGNPWLPRPFAPGANIDG
IGHDLARLHDHFWRRTAAAGPAALVGSLQHWNRREARRREPLPQDVADLP
LTEIAPTATANGRIAVILTGDGGWAGLDQGVAEALSADGVQVVGFSTLKF
FWQAREPDDAAAAVARVIGHYAAGNPDARFAIVGYSFGASLVPVVFNRLP
EAAREKVDLQFMISPDDEAVFEVKVGDWFGGAHHEGALPIAPELVKSPVP
AYCLHGDEEDDSVCPKLTGENVHVLHLPGGHHYDGDYTGLGKLLLQNWPL
RR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRNLIVLLLTALTVDAAAATSPVHYGLFGELHLARPAQTAAQTVLFMSDA
NGWDAREDAYADALAAAGNLVVGIDLPSYLKQLESIKSDCAYPAAHVEEV
SHWIQRHENLVNYSAPWLIGLDRGASLAYAVAAQAPAGTFDGLVTLGFDF
AFRLRKPLCPGDAGKATVADGKRGFRVVPVPRLGNPWLPRPFAPGANIDG
IGHDLARLHDHFWRRTAAAGPAALVGSLQHWNRREARRREPLPQDVADLP
LTEIAPTATANGRIAVILTGDGGWAGLDQGVAEALSADGVQVVGFSTLKF
FWQAREPDDAAAAVARVIGHYAAGNPDARFAIVGYSFGASLVPVVFNRLP
EAAREKVDLQFMISPDDEAVFEVKVGDWFGGAHHEGALPIAPELVKSPVP
AYCLHGDEEDDSVCPKLTGENVHVLHLPGGHHYDGDYTGLGKLLLQNWPL
RR


Reference
    Title: Bioreactor microbial ecosystems for thiocyanate and cyanide degradation unravelled with genome-resolved metagenomics
    Kantor RS, van Zyl AW, van Hille RP, Thomas BC, Harrison ST, Banfield JF
    Ref: Environ Microbiol, 17:4929, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer