Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-a0a1y0ihk7

Oleiphilus messinensis EH66 Alpha/beta fold family hydrolase

Comment
EH66 promiscuous activity 19/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Oleiphilus messinensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Oleiphilaceae: N E > Oleiphilus: N E > Oleiphilus messinensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : KY483650, CP021425, ARU58903
1 UniProt : A0A1Y0IHK7
1 UniProt : A0A1Y0IHK7
1 Interpro : A0A1Y0IHK7
1 Prodom : A0A1Y0IHK7
1 Pfam : A0A1Y0IHK7
1 PIRSF : A0A1Y0IHK7
1 SUPERFAM : A0A1Y0IHK7
Sequence
Graphical view for this peptide sequence: 9gamm-a0a1y0ihk7
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MKYKFIPIQNIEVFYREAGERKNPTIVLLHGYPSSSHMFREVMPILAEKY
HVIAPDYPGFGYTEAPNMDEFEYSFDNLASVVDEWLQALEVDRYFLVVQD
YGAPIGFRIASTHPEKVQGLIIQNGNAYTDGLTDAWASIRDYWRDKTTEN
AAVLRQLCTPDFIKHMYINGVCETKKLSPDAWTLDSSFLSDETRVKIQIE
LFYDYHSNVEKYSQWHEYFKKHQPPALVIWGINDMFFSQKGAECYQNDLE
DIEYNFYDTGHFALEEYGADMSAKILRFADRVTQANLAD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKYKFIPIQNIEVFYREAGERKNPTIVLLHGYPSSSHMFREVMPILAEKY
HVIAPDYPGFGYTEAPNMDEFEYSFDNLASVVDEWLQALEVDRYFLVVQD
YGAPIGFRIASTHPEKVQGLIIQNGNAYTDGLTDAWASIRDYWRDKTTEN
AAVLRQLCTPDFIKHMYINGVCETKKLSPDAWTLDSSFLSDETRVKIQIE
LFYDYHSNVEKYSQWHEYFKKHQPPALVIWGINDMFFSQKGAECYQNDLE
DIEYNFYDTGHFALEEYGADMSAKILRFADRVTQANLAD


Reference
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer