Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-b3vi58

Serratia proteamaculans Oligopeptidase B opdB

Comment
Other strains:Serratia quinivorans Serratia liquefaciens


Relationship
Family|S9N_PREPL_Peptidase_S9
Block| X
Position in NCBI Life Tree|Serratia proteamaculans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Serratia: N E > Serratia proteamaculans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
5 structures (e.g. : 6TF5, 7NE4, 7NE5... more)
No kinetic





3 substrates: BAPNA, Z-KR-pNA, Z-RR-pNA
2 inhibitors: Spermine, Tosyl-L-lysine-chloromethyl-ketone
Sequence
Graphical view for this peptide sequence: 9gamm-b3vi58
Colored MSA for S9N_PREPL_Peptidase_S9 (raw)
MTPPKAEKRPYPITTHGDTRVDDYYWLRDDERTDPQVLDYLQAENAFTDA
ALKPQQALRETLYEEMVARENLYFQSVPYVRHGYRYQTRFEPGNEYAIYV
RQPQAESEHWDTLIDGNQRAEQREFYTLGGLEVSPDNQKLAVAEDFLSRR
QYDIRFKNLSDDSWTDEVLENTSGSFEWANDSATVYYVRKHAKTLLPYQV
YRHVVGTDPQLDELIYEEQDDTFYVGLEKTTSDRFILIHLSSTTTSEILL
LDADRADSTPQMFVPRRKDHEYGIDHYHQHFYIRSNKDGKNFGLYQSEQA
DEAQWQTLIAPRIEVMLEGFSLFRDWLVVEERSEGLTQLRQIHWQSGEVK
RIAFDDPTYTTWLAYNPEPETELLRYGYSSMTTPTTLYELNLDSDERVML
KQQEVKNFTPENYRSERVWVKARDGVEVPVSLVYRHDSFARGTNPLMVYG
YGSYGSSMDPAFSASRLSLLDRGFVFVLAHIRGGGELGQLWYEDGKLFKK
QNTFNDFIDVTEALIAQGYGDAKRVFAMGGAAGGLLMGAVINQAPELFNG
IVAQVPFVDVVTTMLDESIPLTTGEYDEWGNPNQQAYYDYILQYSPYDQV
KAQDYPHMLVTTGLHDSQVQYWEPAKWVAKLRELKTDDRQLLLYTDMDSG
HGGKSGRFKAYEDIALEYAFILALAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTPPKAEKRPYPITTHGDTRVDDYYWLRDDERTDPQVLDYLQAENAFTDA
ALKPQQALRETLYEEMVARENLYFQSVPYVRHGYRYQTRFEPGNEYAIYV
RQPQAESEHWDTLIDGNQRAEQREFYTLGGLEVSPDNQKLAVAEDFLSRR
QYDIRFKNLSDDSWTDEVLENTSGSFEWANDSATVYYVRKHAKTLLPYQV
YRHVVGTDPQLDELIYEEQDDTFYVGLEKTTSDRFILIHLSSTTTSEILL
LDADRADSTPQMFVPRRKDHEYGIDHYHQHFYIRSNKDGKNFGLYQSEQA
DEAQWQTLIAPRIEVMLEGFSLFRDWLVVEERSEGLTQLRQIHWQSGEVK
RIAFDDPTYTTWLAYNPEPETELLRYGYSSMTTPTTLYELNLDSDERVML
KQQEVKNFTPENYRSERVWVKARDGVEVPVSLVYRHDSFARGTNPLMVYG
YGSYGSSMDPAFSASRLSLLDRGFVFVLAHIRGGGELGQLWYEDGKLFKK
QNTFNDFIDVTEALIAQGYGDAKRVFAMGGAAGGLLMGAVINQAPELFNG
IVAQVPFVDVVTTMLDESIPLTTGEYDEWGNPNQQAYYDYILQYSPYDQV
KAQDYPHMLVTTGLHDSQVQYWEPAKWVAKLRELKTDDRQLLLYTDMDSG
HGGKSGRFKAYEDIALEYAFILALAE


References
8 more
    Title: First Crystal Structure of Bacterial Oligopeptidase B in an Intermediate State: The Roles of the Hinge Region Modification and Spermine
    Petrenko DE, Timofeev VI, Britikov VV, Britikova EV, Kleymenov SY, Vlaskina AV, Kuranova IP, Mikhailova AG, Rakitina TV
    Ref: Biology (Basel), 10:, 2021 : PubMed

            

    Title: Molecular dynamics complemented by site-directed mutagenesis reveals significant difference between the interdomain salt bridge networks stabilizing oligopeptidases B from bacteria and protozoa in their active conformations
    Petrenko DE, Mikhailova AG, Timofeev VI, Agapova Y, Karlinsky DM, Komolov AS, Korzhenevskiy DA, Vlaskina AV, Rumsh LD, Rakitina TV
    Ref: J Biomol Struct Dyn, 38:4868, 2020 : PubMed

            

    Title: Activity modulation of the oligopeptidase B from Serratia proteamaculans by site-directed mutagenesis of amino acid residues surrounding catalytic triad histidine
    Mikhailova AG, Rakitina TV, Timofeev VI, Karlinsky DM, Korzhenevskiy DA, Agapova Ycapital Ka C, Vlaskina AV, Ovchinnikova MV, Gorlenko VA, Rumsh LD
    Ref: Biochimie, 139:125, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer