Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-b7rx12

marine gamma proteobacterium HTCC2148 Hydrolase, alpha/beta fold family, putative

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|marine gamma proteobacterium HTCC2148
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Cellvibrionales: N E > Halieaceae: N E > unclassified Halieaceae: N E > marine gamma proteobacterium HTCC2148: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DS999225
1 UniProt : B7RX12
1 UniProt : B7RX12
1 Interpro : B7RX12
1 Prodom : B7RX12
1 Pfam : B7RX12
1 PIRSF : B7RX12
1 SUPERFAM : B7RX12
Sequence
Graphical view for this peptide sequence: 9gamm-b7rx12
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MGKVGLLPEGNYANCANGYKMHYLDEGHGEVVVFLHGSGPGASGHSNFKG
NYPALVAAGYRCIVPDHVGYGFSDKPDDVDHPLSFFVECIKQTLDCAGVE
RCTLVGNSLGGAIAFGLALDYPDLVEKLILMAPGGLSELAEYQKMPGMQK
VFQVFGSGEPVTPQVMKDLFATGLMFNPEHATEELVAERMQIMQIMNGHV
MATMQVPVLVDRLPEIQCPTLGFWGMDEKMMPEEGIMAMVKNIKHMRTIL
VNECGHWVMVEHEAMFNRACVDFLQNG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGKVGLLPEGNYANCANGYKMHYLDEGHGEVVVFLHGSGPGASGHSNFKG
NYPALVAAGYRCIVPDHVGYGFSDKPDDVDHPLSFFVECIKQTLDCAGVE
RCTLVGNSLGGAIAFGLALDYPDLVEKLILMAPGGLSELAEYQKMPGMQK
VFQVFGSGEPVTPQVMKDLFATGLMFNPEHATEELVAERMQIMQIMNGHV
MATMQVPVLVDRLPEIQCPTLGFWGMDEKMMPEEGIMAMVKNIKHMRTIL
VNECGHWVMVEHEAMFNRACVDFLQNG



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer