Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-d0bwk6

Acinetobacter sp. RUH2624 Predicted protein

Comment
Other strains: Acinetobacter sp. (25977_6; 25977_3; 25977_1; 25977_8; 25977_2; 25977_4; 25977_10 796380-1375; 1396970); Acinetobacter baumannii 1571545 25977_9; Acinetobacter nosocomialis NIPH 386; Acinetobacter


Relationship
Family|CFTR-inhibitory-factor_Cif
Block| X
Position in NCBI Life Tree|Acinetobacter sp. RUH2624
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter nosocomialis: N E > Acinetobacter sp. RUH2624: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 4MEA, 4MEB
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9gamm-d0bwk6
Colored MSA for CFTR-inhibitory-factor_Cif (raw)
MKKFFKVMTLSAAMGMFGLNQANAEYDPNLKSIDTPPAVSQQMFNKVKSN
GLGQYAYAKGLSSKFIESEGVKLHYVEGGSKGTPIVFIHGFGSTWKMWEP
VMLSYMKDHKVIAIDLPGLGQSGPILNDDYSAENTSKILIGAIKKIAGKG
PIYYVSHDLGNTASYPLVANNQGYIKKAVFMDSPIPDRAMFEYPGYTADG
PGLGWHFGYFSFGDIAEKQIANDPNLFFSYFIKTYAGKKEIFTPELLAEL
IEPYSTRDKLKAAFGYYRSHADSIRQNEALLANGKKLTIPSMALTGQKGV
NDVLVKEMRARFVADPAQYTAIILPDTGHWMVEENAEGVEKSLSNFLFK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKFFKVMTLSAAMGMFGLNQANAEYDPNLKSIDTPPAVSQQMFNKVKSN
GLGQYAYAKGLSSKFIESEGVKLHYVEGGSKGTPIVFIHGFGSTWKMWEP
VMLSYMKDHKVIAIDLPGLGQSGPILNDDYSAENTSKILIGAIKKIAGKG
PIYYVSHDLGNTASYPLVANNQGYIKKAVFMDSPIPDRAMFEYPGYTADG
PGLGWHFGYFSFGDIAEKQIANDPNLFFSYFIKTYAGKKEIFTPELLAEL
IEPYSTRDKLKAAFGYYRSHADSIRQNEALLANGKKLTIPSMALTGQKGV
NDVLVKEMRARFVADPAQYTAIILPDTGHWMVEENAEGVEKSLSNFLFK


Reference
    Title: Signature motifs identify an acinetobacter cif virulence factor with epoxide hydrolase activity
    Bahl CD, Hvorecny KL, Bridges AA, Ballok AE, Bomberger JM, Cady KC, O'Toole GA, Madden DR
    Ref: Journal of Biological Chemistry, 289:7460, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer