(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Alteromonadales: NE > Idiomarinaceae: NE > Idiomarina: NE > Idiomarina xiamenensis: NE > Idiomarina xiamenensis 10-D-4: NE
Est-OsmC : 9gamm-k2ka44Idiomarina xiamenensis 10-D-4 esterase found in n-term of an OsmC/Ohr family domain. NLS3-Tex30 : 9gamm-k2kal0Idiomarina xiamenensis 10-D-4 Uncharacterized protein
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MWLYLHGFESSPASEKAVLVGDFLRQQLTSEQSLARCYQVPAIPATVTAT RELLMGLVEQHRQTPISGIVGSSLGGFWAHWLASQLACRALLINPAVYPA QLLQHYAGERIHPYSGERYHLQQADLDGLRQMQTELRDDAELWVLLQRGD ETLDYRLAASFYRHQRLTIEAGGNHRFAGFSRYLPALQRFFSAP
Reference
Title: Genome sequence of Idiomarina xiamenensis type strain 10-D-4 Lai Q, Wang L, Wang W, Shao Z Ref: Journal of Bacteriology, 194:6938, 2012 : PubMed
Idiomarina xiamenensis strain 10-D-4(T) was isolated from an oil-degrading consortium enriched from surface seawater around the Xiamen island. Here, we present the draft genome of strain 10-D-4(T), which contains 2,899,282 bp with a G+C content of 49.48% and contains 2,673 protein-coding genes and 43 tRNA genes.