Gene_locus Report for: 9gamm-n9pz46Acinetobacter sp., Acinetobacter gyllenbergii, 3-oxoadipate enol-lactonase Comment Other strains: Acinetobacter sp. (NIPH 2168; WC-323; ANC 3880; ANC 3929; NIPH 758; NIPH 2100; NIPH 3623), Acinetobacter gyllenbergii (CIP 110306; MTCC 11365; NIPH 230) Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp. NIPH 2168: N E Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Acinetobacter sp. WC-323: N, E.
Acinetobacter sp. ANC 3880: N, E.
Acinetobacter sp. ANC 3929: N, E.
Acinetobacter gyllenbergii CIP 110306: N, E.
Acinetobacter sp. NIPH 758: N, E.
Acinetobacter sp. NIPH 2100: N, E.
Acinetobacter sp. NIPH 3623: N, E.
Acinetobacter gyllenbergii MTCC 11365: N, E.
Acinetobacter gyllenbergii NIPH 230: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
>3 Genbank links 6 more: APRW01000009, AMZS01000026, APSD01000027<9 Genbank links 6 less: APRW01000009, AMZS01000026, APSD01000027, APRH01000023, ATGG01000014, APPC01000018, APSA01000007, ASQH01000021, AYEQ01000123 |
Sequence Graphical view for this peptide sequence: 9gamm-n9pz46
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MVTHINNRQGHPLAVQVQGRKDAPVIMFSNSLGTDHGMWQAQVTALAEHY
QVITYDTRGHGTSTVIADTTLQNLAEDVVDILDALAVEKVHFCGISMGGI
TALALAIDHAERFHSITVANSAAKIGNAEAWNTRADSVEQNGLAELVKTT
HTRWFSEHFDYAHDVLAQKTIQSLAVTPAQGYANACRALADADVREQLCQ
IQLPTLIIAGQYDPITTVQDAEFMHQHIANSQLEILAASHLSNIEQPQVF
KQALSKFIQNI
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MVTHINNRQGHPLAVQVQGRKDAPVIMFSNSLGTDHGMWQAQVTALAEHY
QVITYDTRGHGTSTVIADTTLQNLAEDVVDILDALAVEKVHFCGISMGGI
TALALAIDHAERFHSITVANSAAKIGNAEAWNTRADSVEQNGLAELVKTT
HTRWFSEHFDYAHDVLAQKTIQSLAVTPAQGYANACRALADADVREQLCQ
IQLPTLIIAGQYDPITTVQDAEFMHQHIANSQLEILAASHLSNIEQPQVF
KQALSKFIQNI
|
|
|
|
