Gene_locus Report for: 9gamm-q1n4r8Oceanobacter sp. RED65 esterase/lipase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Oceanospirillaceae: N E > Bermanella: N E > Bermanella marisrubri: N E
6_AlphaBeta_hydrolase : 9gamm-q1mxm8Oceanobacter sp. RED65 hypothetical protein, 9gamm-q1mxz6Oceanobacter sp. RED65 decarboxylase, 9gamm-q1mxz9Oceanobacter sp. RED65 esterase/lipase/thioesterase family protein, 9gamm-q1n0m8Oceanobacter sp. RED65 hydrolase, alpha/beta fold family protein, 9gamm-q1n0m9Oceanobacter sp. RED65 alpha/beta hydrolase fold protein, 9gamm-q1n3e3Oceanobacter sp. RED65 hydrolase, alpha/beta fold family protein, 9gamm-q1n104Oceanobacter sp. RED65 probable hydrolase. A85-EsteraseD-FGH : 9gamm-q1mxs9Oceanobacter sp. RED65 putative esterase. ABHD6-Lip : 9gamm-q1n052Oceanobacter sp. RED65 AlphaBeta_hydrolase superfamily protein. ABHD13-BEM46 : 9gamm-q1n049Oceanobacter sp. RED65 lipoprotein, putative. abh_upf00227 : 9gamm-q1n2l6Oceanobacter sp. RED65 predicted esterase. Atu1826-like : 9gamm-q1n071Oceanobacter sp. RED65 hypothetical protein. Bacterial_lip_FamI.1 : 9gamm-q1n359Oceanobacter sp. RED65 lactonizing lipase. BioH : 9gamm-q1mzv8Oceanobacter sp. RED65 bioh protein. Cocaine_esterase : 9gamm-q1n422Oceanobacter sp. RED65 predicted acyl esterases. Epoxide_hydrolase : 9gamm-q1n148Oceanobacter sp. RED65 superfamily) protein. Haloalkane_dehalogenase-HLD1 : 9gamm-q1mz21Oceanobacter sp. RED65 haloalkane dehalogenase (EC 3.8.1.5). Homoserine_transacetylase : 9gamm-q1n435Oceanobacter sp. RED65 homoserine o-acetyltransferase. Hormone-sensitive_lipase_like : 9gamm-q1n6r7Oceanobacter sp. RED65 putative lipase/esterase. LYsophospholipase_carboxylesterase : 9gamm-q1n1d7Oceanobacter sp. RED65 predicted esterase. Monoglyceridelipase_lysophospholip : 9gamm-q1mzl1Oceanobacter sp. RED65 lysophospholipase, 9gamm-q1n0p4Oceanobacter sp. RED65 lysophospholipase Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Bermanella marisrubri: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9gamm-q1n4r8
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MLFQSLFVESKFPHKLHLMHISQTGHESTPVVLMVHGMVEDGRIFYHKSG
KGLVCFLVGQGYQVFVLDLRGMGLSTPKVSAASDHGQTETITEDIPLVMD
YILEKTGQARLHIAAHSWGGVNVNALLLRYSERVKQVASCVYFGSKRTVR
VRNFDRYLKIDLVWKHLSTRIAERKGYLPAVKYKIGSQNETLKAHRQCVE
WVSRSSWIDSDDGFNYGAASQTNSLPPTLYFAAIKDFSLGHRHDVKRFMA
ESGLGVKQYQLLGRKMGNRLDYDHINMLTAPECSKDHFPNVVQWFAKYL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MLFQSLFVESKFPHKLHLMHISQTGHESTPVVLMVHGMVEDGRIFYHKSG
KGLVCFLVGQGYQVFVLDLRGMGLSTPKVSAASDHGQTETITEDIPLVMD
YILEKTGQARLHIAAHSWGGVNVNALLLRYSERVKQVASCVYFGSKRTVR
VRNFDRYLKIDLVWKHLSTRIAERKGYLPAVKYKIGSQNETLKAHRQCVE
WVSRSSWIDSDDGFNYGAASQTNSLPPTLYFAAIKDFSLGHRHDVKRFMA
ESGLGVKQYQLLGRKMGNRLDYDHINMLTAPECSKDHFPNVVQWFAKYL
|
|
|
|
