Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-s5tv80

Cycloclasticus zancles 78-ME, EH62 ,2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase

Comment
EH62promiscuous activity 20/96 substrates Martinez-Martinez et al. 2018 ; Other strains: Cycloclasticus zancles 78-ME; Cycloclasticus sp. (P1; DSM 27168)


Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Cycloclasticus zancles 78-ME
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Thiotrichales: N E > Piscirickettsiaceae: N E > Cycloclasticus: N E > Cycloclasticus zancles: N E > Cycloclasticus zancles 78-ME: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AGS39005, WP_015006593
3 UniProt : S5TV80, K0C3D0, A0A1M6CBV8
3 UniProt : S5TV80, K0C3D0, A0A1M6CBV8
3 Interpro : S5TV80, K0C3D0, A0A1M6CBV8
3 Prodom : S5TV80, K0C3D0, A0A1M6CBV8
3 Pfam : S5TV80, K0C3D0, A0A1M6CBV8
3 PIRSF : S5TV80, K0C3D0, A0A1M6CBV8
3 SUPERFAM : S5TV80, K0C3D0, A0A1M6CBV8
Sequence
Graphical view for this peptide sequence: 9gamm-s5tv80
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MSFEMVEKMIPSGELASNCIIAGNPKNPPLLLLHGAGPGASAMSNWAQCA
PILAKDFYVIAPDAIGFGQSELPKEVPTKIARWMGYRVEQIKGLLDELGI
EKTHIIGNSMGGALAMQCVVEMPDRFDKCMLMGAIGAPFEKSSTLTRMMT
FYDDPRKARYRELIQSFVYDPSIFEDLEAVMQDRFDKAMDPKMRPIQEVM
FKAMNEEMNTVLVIPPPILASMDHEWAIIHGRQDKVVPLETSMYFLQHLK
RAELHVLDRCGHWAQTQRWDGMYPIIMSHFLGKEIRC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSFEMVEKMIPSGELASNCIIAGNPKNPPLLLLHGAGPGASAMSNWAQCA
PILAKDFYVIAPDAIGFGQSELPKEVPTKIARWMGYRVEQIKGLLDELGI
EKTHIIGNSMGGALAMQCVVEMPDRFDKCMLMGAIGAPFEKSSTLTRMMT
FYDDPRKARYRELIQSFVYDPSIFEDLEAVMQDRFDKAMDPKMRPIQEVM
FKAMNEEMNTVLVIPPPILASMDHEWAIIHGRQDKVVPLETSMYFLQHLK
RAELHVLDRCGHWAQTQRWDGMYPIIMSHFLGKEIRC


Reference
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer