Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-urc15994

Psychrobacter celer strain PU3 lipase

Relationship
Family|Bacterial_lip_FamI.1
Block| L
Position in NCBI Life Tree|Psychrobacter celer
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Paranitrophenyl-laurate
1 inhbitor:
PMSF
2 Genbank : URC15994, MW561598
Sequence
Graphical view for this peptide sequence: 9gamm-urc15994
Colored MSA for Bacterial_lip_FamI.1 (raw)
MTLSLYIRAALTPRTFLPILGSISTGVLLMTMQTISAQAAGSFYNCANAT
GCQKVDSKWWTSSHTDTKYPLVMTHGLVGFTKLLGIDYFYGIPQTLMKGG
SEVYATKTSSFNDSRVRGEQLLRQVKTISAVSGSPKVNLLGHSHGGHDIR
YVAGVAPQYVASVTAVASPGQGAALADWVVEQIDNDRINGEYNTATKAAL
TLFGFLGDFMDLNAGIPIDELQDQDGFGAVTALTTDYTKDFNREFSAAMP
TSYCGQPTAIKVNGISYYSFSGVDQVTNVLDPTDYMMLATSQAYDDPNDG
LVSACSSRLGYVIRDDYKMNHLDSVNQLLGLVAWGQPNPKTVYRTQVNRL
KNANL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLSLYIRAALTPRTFLPILGSISTGVLLMTMQTISAQAAGSFYNCANAT
GCQKVDSKWWTSSHTDTKYPLVMTHGLVGFTKLLGIDYFYGIPQTLMKGG
SEVYATKTSSFNDSRVRGEQLLRQVKTISAVSGSPKVNLLGHSHGGHDIR
YVAGVAPQYVASVTAVASPGQGAALADWVVEQIDNDRINGEYNTATKAAL
TLFGFLGDFMDLNAGIPIDELQDQDGFGAVTALTTDYTKDFNREFSAAMP
TSYCGQPTAIKVNGISYYSFSGVDQVTNVLDPTDYMMLATSQAYDDPNDG
LVSACSSRLGYVIRDDYKMNHLDSVNQLLGLVAWGQPNPKTVYRTQVNRL
KNANL


Reference
    Title: Functional and molecular characterization of a cold-active lipase from Psychrobacter celer PU3 with potential antibiofilm property
    Esakkiraj P, Bharathi C, Ayyanna R, Jha N, Panigrahi A, Karthe P, Arul V
    Ref: Int J Biol Macromol, :, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer