Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gent-CorS

Tabernanthe iboga Coronaridine synthase CorS

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Tabernanthe iboga
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Gentianales: N E > Apocynaceae: N E > Rauvolfioideae: N E > Tabernaemontaneae: N E > Tabernaemontaninae: N E > Tabernanthe: N E > Tabernanthe iboga: N E


Molecular evidence
Database
No mutation
1 structure:
6RJ8: Structure of the alpha-beta hydrolase CorS (Coronaridine synthase) from Tabernathe iboga
No kinetic





No Substrate
No inhibitor
2 Genbank : MK840854, QED20593
1 UniProt : A0A5B8X6B5
1 Structure : 6RJ8
1 UniProt : A0A5B8X6B5
1 Interpro : A0A5B8X6B5
1 Prodom : A0A5B8X6B5
1 Pfam : A0A5B8X6B5
1 PIRSF : A0A5B8X6B5
1 SUPERFAM : A0A5B8X6B5
Sequence
Graphical view for this peptide sequence: 9gent-CorS
Colored MSA for Plant_carboxylesterase (raw)
MANSTANSDEIVFDLHPYIRVFKNGKVERLHDTPYVPPSLEDPATGVSWK
DVPISSDVSARVYLPKISEAEKKKLPIFVYFHGAGFCLESAFKSFFHTYV
KHVVAETKAVGVSVEYRLAPEHPLPAAYEDCWTALQWVASHVGLDNSSLK
NAIDKEPWIINHGDLNKLYLGGDSPGGNIVHNVLIRAGKESLHGGVKIRG
AILYYPYFLIRTSKRQSDYMEIDYRGYWKLAYPSAPGGTDNPMINPVAKN
APDLAGYGCSRLLVSMVSDETRDITLLYLEALKKSGWKGELEVGDYEAHF
FDLFSPENEVGKTWIKRSSDFINKE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANSTANSDEIVFDLHPYIRVFKNGKVERLHDTPYVPPSLEDPATGVSWK
DVPISSDVSARVYLPKISEAEKKKLPIFVYFHGAGFCLESAFKSFFHTYV
KHVVAETKAVGVSVEYRLAPEHPLPAAYEDCWTALQWVASHVGLDNSSLK
NAIDKEPWIINHGDLNKLYLGGDSPGGNIVHNVLIRAGKESLHGGVKIRG
AILYYPYFLIRTSKRQSDYMEIDYRGYWKLAYPSAPGGTDNPMINPVAKN
APDLAGYGCSRLLVSMVSDETRDITLLYLEALKKSGWKGELEVGDYEAHF
FDLFSPENEVGKTWIKRSSDFINKE


Reference
    Title: Structural basis of cycloaddition in biosynthesis of iboga and aspidosperma alkaloids
    Caputi L, Franke J, Bussey K, Farrow SC, Vieira IJC, Stevenson CEM, Lawson DM, O'Connor SE
    Ref: Nat Chemical Biology, 16:383, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer