Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9hemi-e2j7h3

Triatoma matogrossensis Acetylcholinesterase

Comment
sequence split in two genes: error


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Triatoma matogrossensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Prosorrhyncha: N E > Heteroptera: N E > Euheteroptera: N E > Neoheteroptera: N E > Panheteroptera: N E > Cimicomorpha: N E > Reduvioidea: N E > Reduviidae: N E > Triatominae: N E > Triatoma: N E > Triatoma matogrossensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : HP429391, HP429390
2 UniProt : E2J7H3, E2J7H2
2 UniProt : E2J7H3, E2J7H2
2 Interpro : E2J7H3, E2J7H2
2 Pfam : E2J7H3, E2J7H2
2 PIRSF : E2J7H3, E2J7H2
2 SUPERFAM : E2J7H3, E2J7H2
Sequence
Graphical view for this peptide sequence: 9hemi-e2j7h3
Colored MSA for ACHE (raw)
DPLVVHTNKGRVQGITPQAATGKYVDAWLGIPYAQKPIGNLRFRHPRPID
KWTHILNATRPPNTCVQIIDTVFGDFPGATMWNPNTHISEDCLYLNVVVP
KPRPTNAAVMLWIFGGGFYSGSATLDVYDHKTLVSEENVIVVSMQYRVAS
LGFLFFDTPEAPGNAGLFDQLMALQWVHDNIHQFGGNPHNVTLFGESAGA
VSVSLHLLSPLSRNLFSQAIMESGSAVAPWAIISRQESTLRGLRLAEAVN
CPHSRSDIAAVIECLRKVNATDLVANEWGTLGICEFPFVPIVDGTFVDDL
PQRSLATRNFKKTNILMGSNTEEGYYFIIYYLTELFRKEENVYVNREEFL
QAVRELNPYVNNVARQAIVFEYTDWQNPDDPIKNRDALDKMVGDYQFTCN
VNEFAHIYAETGNNVYMYLFTHRSFNNPWPSWTGVMHGDEINYIFGEPLN
AAKNYQPQEIELSKRIMNFWANFAKTGNPNLQSDNTWTSTFWPLHTAFGR
EYLTLGINASAGGGRGPRVKQCAFWKKYLPQLISST
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

DPLVVHTNKGRVQGITPQAATGKYVDAWLGIPYAQKPIGNLRFRHPRPID
KWTHILNATRPPNTCVQIIDTVFGDFPGATMWNPNTHISEDCLYLNVVVP
KPRPTNAAVMLWIFGGGFYSGSATLDVYDHKTLVSEENVIVVSMQYRVAS
LGFLFFDTPEAPGNAGLFDQLMALQWVHDNIHQFGGNPHNVTLFGESAGA
VSVSLHLLSPLSRNLFSQAIMESGSAVAPWAIISRQESTLRGLRLAEAVN
CPHSRSDIAAVIECLRKVNATDLVANEWGTLGICEFPFVPIVDGTFVDDL
PQRSLATRNFKKTNILMGSNTEEGYYFIIYYLTELFRKEENVYVNREEFL
QAVRELNPYVNNVARQAIVFEYTDWQNPDDPIKNRDALDKMVGDYQFTCN
VNEFAHIYAETGNNVYMYLFTHRSFNNPWPSWTGVMHGDEINYIFGEPLN
AAKNYQPQEIELSKRIMNFWANFAKTGNPNLQSDNTWTSTFWPLHTAFGR
EYLTLGINASAGGGRGPRVKQCAFWKKYLPQLISST



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer