Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9hyme-a0a151wg00

Trachymyrmex zeteki. Carboxylic ester hydrolase

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Trachymyrmex zeteki
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Hymenoptera: N E > Apocrita: N E > Aculeata: N E > Vespoidea: N E > Formicidae: N E > Myrmicinae: N E > Attini: N E > Trachymyrmex: N E > Trachymyrmex zeteki: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KQ983203
1 UniProt : A0A151WG00
1 UniProt : A0A151WG00
1 Interpro : A0A151WG00
1 Pfam : A0A151WG00
1 PIRSF : A0A151WG00
1 SUPERFAM : A0A151WG00
Sequence
Graphical view for this peptide sequence: 9hyme-a0a151wg00
Colored MSA for Carb_B_Arthropoda (raw)
MLLQLLLIVLLTFDFTIHANIDETAPKVRTSLGGLKGYYKTSQNGRKYEA
YEGVPYALPPVGKLRFKSPRPIPAWIGELSATKLSAVCIQYDQVPEHPPE
KVVGAEDCLYLNVYVPVREKGENKIPMPIIFWIHGGAFQCGSGILYGPKY
LMDHDVILVTINYRLGPMGFLSTEDEVVPGNMGLKDQSMALRWVSQNIEW
FGGDPKKVTLVGLSAGGASVHYHYLSQMSAGLFRNGISFSGTAFDCWTQA
ENSLEKAKKLSALMGCPTTTSRSMIRCLRYRPARAIVQTTSEFMPFFFNP
FTPFGPVAEKFGDETPFIDRTPIEIINSGDIQDIPWVTGVTSEEGLYPVA
EFIADDQNLKQLNDNWDILGPDYLDFNYTIPREKHIEIARLVKKHYFGTK
PINRQSTKELIQMSSDRFFVVDSEKAARMQAKVNKNPVWYHYFTYRGAQS
LSDAYSGTTVNYGVSHGDDVVYVLNTSWVDPLTTQKDRDIQKHLIDFWVL
FATEGIPKVANVEWLRLDPSKKELHYLHIAGPDKINMDSNVNFGEKEFWN
SINFKENILKHSAGINKDEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLQLLLIVLLTFDFTIHANIDETAPKVRTSLGGLKGYYKTSQNGRKYEA
YEGVPYALPPVGKLRFKSPRPIPAWIGELSATKLSAVCIQYDQVPEHPPE
KVVGAEDCLYLNVYVPVREKGENKIPMPIIFWIHGGAFQCGSGILYGPKY
LMDHDVILVTINYRLGPMGFLSTEDEVVPGNMGLKDQSMALRWVSQNIEW
FGGDPKKVTLVGLSAGGASVHYHYLSQMSAGLFRNGISFSGTAFDCWTQA
ENSLEKAKKLSALMGCPTTTSRSMIRCLRYRPARAIVQTTSEFMPFFFNP
FTPFGPVAEKFGDETPFIDRTPIEIINSGDIQDIPWVTGVTSEEGLYPVA
EFIADDQNLKQLNDNWDILGPDYLDFNYTIPREKHIEIARLVKKHYFGTK
PINRQSTKELIQMSSDRFFVVDSEKAARMQAKVNKNPVWYHYFTYRGAQS
LSDAYSGTTVNYGVSHGDDVVYVLNTSWVDPLTTQKDRDIQKHLIDFWVL
FATEGIPKVANVEWLRLDPSKKELHYLHIAGPDKINMDSNVNFGEKEFWN
SINFKENILKHSAGINKDEL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer