Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9hyme-e2fz90

Oomyzus sokolowskii Acetylcholinesterase 2

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Oomyzus sokolowskii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Hymenoptera: N E > Apocrita: N E > Terebrantes: N E > Chaldicoidea group: N E > Chalcidoidea: N E > Eulophidae: N E > Tetrastichinae: N E > Oomyzus: N E > Oomyzus sokolowskii: N E


Molecular evidence
Database
3 mutations: TableE115L, F394L, K424R
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : HM212643, HM212644
2 UniProt : E2FZ90, E2FZ91
2 UniProt : E2FZ90, E2FZ91
2 Interpro : E2FZ90, E2FZ91
2 Prodom : E2FZ90, E2FZ91
2 Pfam : E2FZ90, E2FZ91
2 PIRSF : E2FZ90, E2FZ91
2 SUPERFAM : E2FZ90, E2FZ91
Sequence
Graphical view for this peptide sequence: 9hyme-e2fz90
Colored MSA for ACHE (raw)
MEGRACLVLLLLLRPLAARPNDDLFAAHEIAYRGDDYADDPLVVETTTGL
MRGLSRTILDKEVHIYYGVPFAKPPIGPLRFRKPAPLEPWKGVYNATTMP
NSCIQERYEYFPGFEGEEMWNPNTNISEDCLYMNIWVPKKIRLRHKGGGD
SAEKKNHHQGMPILVWIYGGGYMTGTATLDVYDADMMAARSNAIIASMQY
RVGAFGFLYLKDYLEANDDAPGNMGLYDQAMALKWLKDNAKVLGGDPELI
TIFGESAGGGSVSLHLMSPVTKGLARRGILQSGTLNAPWSYMSAERATEV
ARVLVEDCGCNSTMLEDNPKRVMDCMRSVEARTISVQQWNSYGGILGFPS
APTIDGEFLTKDPIEMLKDKKFDKTEIIIGNNENEGTYFILYDFIDYFEK
DNPSSLDRSKFLQIINTIFKNMSKIEREAIAFQYTEWENTNDEYMYQRMV
ADIVADYFFICPSIHFAQLFADTGMKVYYYFFTQKSSTNMWGDWMGVMHG
DEIEYVFGHPLNTSLRYTERERELALRMILAYSNFALHGQPMDENEWPPY
TRDNPAYYIFNAEKTAVGKGPRTTACAFWNEFMPRLKGVPDPSPESCNGA
VASSVSAGAWALRSDSWLTTPWLLTSLLLLPSSFSLRSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEGRACLVLLLLLRPLAARPNDDLFAAHEIAYRGDDYADDPLVVETTTGL
MRGLSRTILDKEVHIYYGVPFAKPPIGPLRFRKPAPLEPWKGVYNATTMP
NSCIQERYEYFPGFEGEEMWNPNTNISEDCLYMNIWVPKKIRLRHKGGGD
SAEKKNHHQGMPILVWIYGGGYMTGTATLDVYDADMMAARSNAIIASMQY
RVGAFGFLYLKDYLEANDDAPGNMGLYDQAMALKWLKDNAKVLGGDPELI
TIFGESAGGGSVSLHLMSPVTKGLARRGILQSGTLNAPWSYMSAERATEV
ARVLVEDCGCNSTMLEDNPKRVMDCMRSVEARTISVQQWNSYGGILGFPS
APTIDGEFLTKDPIEMLKDKKFDKTEIIIGNNENEGTYFILYDFIDYFEK
DNPSSLDRSKFLQIINTIFKNMSKIEREAIAFQYTEWENTNDEYMYQRMV
ADIVADYFFICPSIHFAQLFADTGMKVYYYFFTQKSSTNMWGDWMGVMHG
DEIEYVFGHPLNTSLRYTERERELALRMILAYSNFALHGQPMDENEWPPY
TRDNPAYYIFNAEKTAVGKGPRTTACAFWNEFMPRLKGVPDPSPESCNGA
VASSVSAGAWALRSDSWLTTPWLLTSLLLLPSSFSLRSL


Reference
    Title: Identification and characterization of ace2-type acetylcholinesterase in insecticide-resistant and -susceptible parasitoid wasp Oomyzus sokolowskii (Hymenoptera: Eulophidae)
    Zhuang HM, Li CW, Wu G
    Ref: Mol Biol Rep, 41:7525, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer