Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9hyst-a0a0a1ec83

Fukomys anselli (Ansell's mole-rat). Thyroglobulin

Relationship
Family|Thyroglobulin
Block| C
Position in NCBI Life Tree|Fukomys anselli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Hystricomorpha: N E > Bathyergidae: N E > Fukomys: N E > Fukomys anselli: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KJ958515
1 UniProt : A0A0A1EC83
1 UniProt : A0A0A1EC83
1 Interpro : A0A0A1EC83
1 Prodom : A0A0A1EC83
1 Pfam : A0A0A1EC83
1 PIRSF : A0A0A1EC83
1 SUPERFAM : A0A0A1EC83
Sequence
Graphical view for this peptide sequence: 9hyst-a0a0a1ec83
Colored MSA for Thyroglobulin (raw)
HGWLRGRSQAVRVGTEWKLVEQFLGVPYASPPLADSRFQAPEPLNWTGSW
DATKPRASCWLPGIRTPQPPGVSEDCLYLNVFVPENLAPNTSVLVFFHNN
GEAEVTKGQLTVDGSFLASVGNLIVVTANYRAGVFGFLSSGSSEVPGNWG
LLDQVAALTWVQTHIGAFGGDPQRVSLAADREGADVASIHLLMARTSSPR
LFRRALLMGGSVLSPAAVISPNRAQQQAVTLAKEVSCPTSSSQEVVSCLR
QTPAHVLNDAQTKLLAVSGPFHYWGPVVDGQYLRETPARALQRPPRAKVD
LLIGSSQDDGLINRAKAVKRFEESQGRTESKIAFYQALQNSLGGEDSDAR
VLEAATWYYSLGHSEDDYASFSRALENATRDYFITCPTIDLARLWAKSTR
GNVFMYHAPEIYGHGSLDLLADVQYAFGLPFYPAYEGQFSLEEKSLSLKI
MQFLSNFIRSGNPNYPHEFSRKAPEFAAPWPDFIPGAGRESYQEFSTLLP
IRQSLKEADCSFWSKYIQALKAPAGGALDGQSAGTEDKDLLAGSELGQDF
LDLPEPGPKSYSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

HGWLRGRSQAVRVGTEWKLVEQFLGVPYASPPLADSRFQAPEPLNWTGSW
DATKPRASCWLPGIRTPQPPGVSEDCLYLNVFVPENLAPNTSVLVFFHNN
GEAEVTKGQLTVDGSFLASVGNLIVVTANYRAGVFGFLSSGSSEVPGNWG
LLDQVAALTWVQTHIGAFGGDPQRVSLAADREGADVASIHLLMARTSSPR
LFRRALLMGGSVLSPAAVISPNRAQQQAVTLAKEVSCPTSSSQEVVSCLR
QTPAHVLNDAQTKLLAVSGPFHYWGPVVDGQYLRETPARALQRPPRAKVD
LLIGSSQDDGLINRAKAVKRFEESQGRTESKIAFYQALQNSLGGEDSDAR
VLEAATWYYSLGHSEDDYASFSRALENATRDYFITCPTIDLARLWAKSTR
GNVFMYHAPEIYGHGSLDLLADVQYAFGLPFYPAYEGQFSLEEKSLSLKI
MQFLSNFIRSGNPNYPHEFSRKAPEFAAPWPDFIPGAGRESYQEFSTLLP
IRQSLKEADCSFWSKYIQALKAPAGGALDGQSAGTEDKDLLAGSELGQDF
LDLPEPGPKSYSK


Reference
    Title: Unusual ratio between free thyroxine and free triiodothyronine in a long-lived mole-rat species with bimodal ageing
    Henning Y, Vole C, Begall S, Bens M, Broecker-Preuss M, Sahm A, Szafranski K, Burda H, Dammann P
    Ref: PLoS ONE, 9:e113698, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer