Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9lact-a0a5m9r5n4

Lactococcus garvieae Acetylesterase (LgEstI)

Comment
Other strains: Lactococcus garvieae subsp. garvieae


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Lactococcus garvieae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Lactococcus: N E > Lactococcus garvieae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 7YC0, 7YC4
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_042219410
1 UniProt : A0A5M9R5N4
2 Structure : 7YC0, 7YC4
1 UniProt : A0A5M9R5N4
1 Interpro : A0A5M9R5N4
1 Pfam : A0A5M9R5N4
1 PIRSF : A0A5M9R5N4
1 SUPERFAM : A0A5M9R5N4
Sequence
Graphical view for this peptide sequence: 9lact-a0a5m9r5n4
Colored MSA for Hormone-sensitive_lipase_like (raw)
MVERISLEKAALEFSEANAPHPRIYELPVEEGRSLLNEVQDSPVVKEDVD
IEDIAVDTGEWGEINVRFIRPLHQEKKLPVIFYIHGAGWVFGNAHTHDKL
IRELAVRTNSVVVFSEYSLSPEAKYPTAIEQNYAVLQQLKDFANDKKFDV
NHLTVAGDSVGGNMATVMTLLTKQRGGQKIGQQVLYYPVTDANFDTDSYN
EFAENYFLTKEGMIWFWDQYTTSQEERHQITASPLRATKEDLADLPAALI
ITGEADVLRDEGEAYARKLREADVEVTQVRFQAIIHDFVMVNSMNETHAT
RAAMSLSTQWINEKNRK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVERISLEKAALEFSEANAPHPRIYELPVEEGRSLLNEVQDSPVVKEDVD
IEDIAVDTGEWGEINVRFIRPLHQEKKLPVIFYIHGAGWVFGNAHTHDKL
IRELAVRTNSVVVFSEYSLSPEAKYPTAIEQNYAVLQQLKDFANDKKFDV
NHLTVAGDSVGGNMATVMTLLTKQRGGQKIGQQVLYYPVTDANFDTDSYN
EFAENYFLTKEGMIWFWDQYTTSQEERHQITASPLRATKEDLADLPAALI
ITGEADVLRDEGEAYARKLREADVEVTQVRFQAIIHDFVMVNSMNETHAT
RAAMSLSTQWINEKNRK


Reference
    Title: Sequence Analysis and Preliminary X-ray Crystallographic Analysis of an Acetylesterase (LgEstI) from Lactococcus garvieae
    Do H, Wang Y, Lee CW, Yoo W, Jeon S, Hwang J, Lee MJ, Kim KK, Kim HW and Kim TD <1 more author(s)>
    Ref: Crystals, 12:46, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer