Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9list-w7b4a8

Listeria grandensis FSL F6-971. Uncharacterized protein

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Listeria grandensis FSL F6-971
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria grandensis: N E > Listeria grandensis FSL F6-0971: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AODD01000030
1 UniProt : W7B4A8
1 UniProt : W7B4A8
1 Interpro : W7B4A8
1 Pfam : W7B4A8
1 PIRSF : W7B4A8
1 SUPERFAM : W7B4A8
Sequence
Graphical view for this peptide sequence: 9list-w7b4a8
Colored MSA for AlphaBeta_hydrolase (raw)
MKKLLAKLYFQIIGKTATQSNGIKLRYLLQKDRQSQDLLVIFSAFPRAGM
SATYNYVNTLKEVPGNKLFILDDFGFQKRGVYYLCEQGSFQIRDAVEELI
TKITQDMKATQTTYIGSSKGGYAALYFGFRLGATNVISGAPQYFVGEYLR
AEPERIPTLTSMLGEISEAKIQQLDHMLKEAISEKEAPNIYLHYSDKEHT
YKSHIEPLLSQLADEQIKVERDIEQYVSHADVRNYFPPYLLQILAKIRGE
LS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKLLAKLYFQIIGKTATQSNGIKLRYLLQKDRQSQDLLVIFSAFPRAGM
SATYNYVNTLKEVPGNKLFILDDFGFQKRGVYYLCEQGSFQIRDAVEELI
TKITQDMKATQTTYIGSSKGGYAALYFGFRLGATNVISGAPQYFVGEYLR
AEPERIPTLTSMLGEISEAKIQQLDHMLKEAISEKEAPNIYLHYSDKEHT
YKSHIEPLLSQLADEQIKVERDIEQYVSHADVRNYFPPYLLQILAKIRGE
LS


Reference
    Title: Listeria floridensis sp. nov., Listeria aquatica sp. nov., Listeria cornellensis sp. nov., Listeria riparia sp. nov. and Listeria grandensis sp. nov., from agricultural and natural environments
    den Bakker HC, Warchocki S, Wright EM, Allred AF, Ahlstrom C, Manuel CS, Stasiewicz MJ, Burrell A, Roof S and Wiedmann M <4 more author(s)>
    Ref: Int J Syst Evol Microbiol, 64:1882, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer