Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9mico-q3mnp3

Terrabacter sp. DBF63 beta-ketoadipate enol-lactone hydrolase

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Terrabacter sp. DBF63
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Intrasporangiaceae: N E > Terrabacter: N E > Terrabacter sp. DBF63: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP008980
1 UniProt : Q3MNP3
1 UniProt : Q3MNP3
1 Interpro : Q3MNP3
1 Prodom : Q3MNP3
1 Pfam : Q3MNP3
1 PIRSF : Q3MNP3
1 SUPERFAM : Q3MNP3
Sequence
Graphical view for this peptide sequence: 9mico-q3mnp3
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MAEPDLTATRLAGGPESPRLLVVGPSLGTSVEALWEATARRLAYDFEVVG
WDLPGHGRSKPATGPFTVGELAAAVRRLAADVAGDRPAAYAGVSLGGAVA
LELALDPGVFTAVACIASAAKIGEPSAWHERAALVRKAGTPVMVSGSSER
WFAPGFLMRDPATGTRLLLSLADADKDSYALACEALADFDVRDRLADATV
PLLVAPGDQDVVISPHTARETTADRAPNSSMNVFTGCGHLPPAEDPDAVA
RALNDFATGGKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAEPDLTATRLAGGPESPRLLVVGPSLGTSVEALWEATARRLAYDFEVVG
WDLPGHGRSKPATGPFTVGELAAAVRRLAADVAGDRPAAYAGVSLGGAVA
LELALDPGVFTAVACIASAAKIGEPSAWHERAALVRKAGTPVMVSGSSER
WFAPGFLMRDPATGTRLLLSLADADKDSYALACEALADFDVRDRLADATV
PLLVAPGDQDVVISPHTARETTADRAPNSSMNVFTGCGHLPPAEDPDAVA
RALNDFATGGKR


References
4 more
    Title: Characterization of [3Fe-4S] ferredoxin DbfA3, which functions in the angular dioxygenase system of Terrabacter sp. strain DBF63
    Takagi T, Habe H, Yoshida T, Yamane H, Omori T, Nojiri H
    Ref: Applied Microbiology & Biotechnology, 68:336, 2005 : PubMed

            

    Title: Genetic characterization of the dibenzofuran-degrading Actinobacteria carrying the dbfA1A2 gene homologues isolated from activated sludge
    Noumura T, Habe H, Widada J, Chung JS, Yoshida T, Nojiri H, Omori T
    Ref: FEMS Microbiology Letters, 239:147, 2004 : PubMed

            

    Title: Cloning and characterization of genes involved in the degradation of dibenzofuran by Terrabacter sp. strain DBF63.
    Kasuga K, Nojiri H, Yamane H, Kodama T, Omori T
    Ref: J Ferment Bioeng, 84:387, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer