Gene_locus Report for: 9myco-a0a0j6wgd8Mycobacterium chubuense, Uncharacterized protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium chubuense: N E
Abhydrolase_9 : myccn-i4bng0Mycobacterium chubuense (strain NBB4) Putative membrane protein, myccn-i4bpi3Mycobacterium chubuense (strain NBB4) Putative membrane protein. Carboxymethylbutenolide_lactonase : myccn-i4bcv7Mycobacterium chubuense (strain NBB4). 3-oxoadipate enol-lactonase. Carb_B_Bacteria : myccn-i4bep6Mycobacterium chubuense (strain NBB4) Carboxylesterase type B, myccn-i4bg47Mycobacterium chubuense (strain NBB4) Carboxylesterase type B, myccn-i4bil0Mycobacterium chubuense (strain NBB4) Carboxylesterase type B, myccn-i4bjn9Mycobacterium chubuense (strain NBB4) Carboxylesterase type B, myccn-i4bki4Mycobacterium chubuense (strain NBB4) Carboxylesterase type B, 9myco-a0a0j6vhk3Mycobacterium chubuense Uncharacterized protein. Duf_1023 : myccn-i4be24Mycobacterium chubuense, Uncharacterized protein, myccn-i4bkm1Mycobacterium chubuense, Uncharacterized protein. Hormone-sensitive_lipase_like : 9myco-a0a0j6vre4Mycobacterium chubuense. Carboxylesterase NlhH, myccn-i4be16Mycobacterium chubuense (strain NBB4). Esterase/lipase. NLS3-Tex30 : myccn-i4bdg3Mycobacterium chubuense (strain NBB4) Alpha/beta hydrolase superfamily enzyme, predicted hydrolase. Xaa-Pro-like_dom : myccn-i4bhz4Mycobacterium chubuense (strain NBB4). X-Pro dipeptidyl-peptidase (S15 family) Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Mycobacterium chubuense NBB4: N, E.
Mycolicibacterium chubuense: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9myco-a0a0j6wgd8
Colored MSA for Duf_1023 (raw)
LAEVDDPTRAGGRIQRQILAFDPARSSLVELHGDLATTRSVAVLVPGVNT
TIEGSAATAATARRFVSGSHGDTAVITYLGGPFPQVHDPAAVLLEAADPR
SALDMAPRLVAFSEDVDRTVAPGVPVTVIGHSYGGSIVGTAEALGLTSDR
TLFLAAAGSGVGVDDPSDWHNRNPDVLRFSMTAPGDFIEAVQGIPGGPHG
ADPDEMPGVIRLRAGFYDDGRPVAGWEAHSGMLNRPSDSWRTVLAVITGD
SETLHRAVADAPQ
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
LAEVDDPTRAGGRIQRQILAFDPARSSLVELHGDLATTRSVAVLVPGVNT
TIEGSAATAATARRFVSGSHGDTAVITYLGGPFPQVHDPAAVLLEAADPR
SALDMAPRLVAFSEDVDRTVAPGVPVTVIGHSYGGSIVGTAEALGLTSDR
TLFLAAAGSGVGVDDPSDWHNRNPDVLRFSMTAPGDFIEAVQGIPGGPHG
ADPDEMPGVIRLRAGFYDDGRPVAGWEAHSGMLNRPSDSWRTVLAVITGD
SETLHRAVADAPQ
|
|
|
|
