Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9myco-a0a1v4pju7

Mycobacterium sp. AT1. Alpha/beta hydrolase

Relationship
Family|Xaa-Pro-like_dom
Block| X
Position in NCBI Life Tree|Mycobacterium sp. AT1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium sp. AT1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : MVOC01000056
1 UniProt : A0A1V4PJU7
1 UniProt : A0A1V4PJU7
1 Interpro : A0A1V4PJU7
1 Prodom : A0A1V4PJU7
1 Pfam : A0A1V4PJU7
1 PIRSF : A0A1V4PJU7
1 SUPERFAM : A0A1V4PJU7
Sequence
Graphical view for this peptide sequence: 9myco-a0a1v4pju7
Colored MSA for Xaa-Pro-like_dom (raw)
MTFTHAEAHFDSEGTRCAVRVYRPHVDGAAAPVVVMAHGFGGVRTLRLYA
YAERFAAAGYAVVVFDYRGFGDSDGQPRQVLDIKAQHADWRSALGFARQL
PDVDSARVVAWGTSLAGGHVIALAGSGVPLAAVIAQVPHVSGPAAVRATG
VLAGLRLAPSALRDQLRAWRHRAPVYVDSAGAPGATAIITSPDALPGMRR
LIAESGPDAASAPLFVAARVALKIGLYSPGRQARGVSCPTLVQVAAHDAV
TPRRVALQAANAMARPTVHTYDCGHFDPYVEPFFSTVVADQLAFLAANVP
VAHSR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTFTHAEAHFDSEGTRCAVRVYRPHVDGAAAPVVVMAHGFGGVRTLRLYA
YAERFAAAGYAVVVFDYRGFGDSDGQPRQVLDIKAQHADWRSALGFARQL
PDVDSARVVAWGTSLAGGHVIALAGSGVPLAAVIAQVPHVSGPAAVRATG
VLAGLRLAPSALRDQLRAWRHRAPVYVDSAGAPGATAIITSPDALPGMRR
LIAESGPDAASAPLFVAARVALKIGLYSPGRQARGVSCPTLVQVAAHDAV
TPRRVALQAANAMARPTVHTYDCGHFDPYVEPFFSTVVADQLAFLAANVP
VAHSR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer