Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9myco-i2acb5

Mycobacterium sp. Mycobacterium intracellulare; Mycobacterium avium; Mycobacterium yongonense; Mycobacterium indicus pranii, Haloalkane dehalogenase

Comment
Other strains: Mycobacterium sp. (MOTT36Y; H4Y); Mycobacterium intracellulare (MOTT-64; MIN_052511_1280; MIN_061107_1834; MOTT-02; ATCC 13950 / DSM 43223 / JCM 6384 / NCTC 13025 / 3600); Mycobacterium avium 2285 (S); Mycobacterium yongonense 05-1390; Mycobacterium indicus pranii MTCC 9506


Relationship
Family|Haloalkane_dehalogenase-HLD1
Block| X
Position in NCBI Life Tree|Mycobacterium sp. MOTT36Y
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium sp. MOTT36Y: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: CP003491, AKIG01000001, CP003324
>3 UniProt links 2 more: I2ACB5, X8A7S0, S4Z9H7
>3 UniProt links 2 more: I2ACB5, X8A7S0, S4Z9H7
>3 Interpro links 2 more: I2ACB5, X8A7S0, S4Z9H7
>3 Prodom links 2 more: I2ACB5, X8A7S0, S4Z9H7
>3 Pfam links 2 more: I2ACB5, X8A7S0, S4Z9H7
>3 PIRSF links 2 more: I2ACB5, X8A7S0, S4Z9H7
>3 SUPERFAM links 2 more: I2ACB5, X8A7S0, S4Z9H7
Sequence
Graphical view for this peptide sequence: 9myco-i2acb5
Colored MSA for Haloalkane_dehalogenase-HLD1 (raw)
MHVLRTPDSRFENLEGYPFVAHYLDVTASDTRPLRMHYLDEGPIEGPPIV
LLHGEPTWSYLYRSMITPLTDAGNRVLAPDLIGFGRSDKPSRIEDYTYQR
HVEWVVSWFEHLNLTDVTLLVQDWGSLIGLRIAAEQPDRVGRLVVANGFL
PTAQRRTPPAFHAWRAFARYSPVLPAGRIVGAGTVRRVSSKVRAGYDAPF
PDKSYQAGARAFPRLVPTSPSDPAIPANRRAWEALGRWEKPFLAIFGARD
PILGQADTPLIKHIPGAAGQPHARINASHFIQEDRGPELAARVLSWQQAL
L
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHVLRTPDSRFENLEGYPFVAHYLDVTASDTRPLRMHYLDEGPIEGPPIV
LLHGEPTWSYLYRSMITPLTDAGNRVLAPDLIGFGRSDKPSRIEDYTYQR
HVEWVVSWFEHLNLTDVTLLVQDWGSLIGLRIAAEQPDRVGRLVVANGFL
PTAQRRTPPAFHAWRAFARYSPVLPAGRIVGAGTVRRVSSKVRAGYDAPF
PDKSYQAGARAFPRLVPTSPSDPAIPANRRAWEALGRWEKPFLAIFGARD
PILGQADTPLIKHIPGAAGQPHARINASHFIQEDRGPELAARVLSWQQAL
L


References
5 more
    Title: Whole-Genome Sequence of Mycobacterium intracellulare Clinical Strain MOTT-H4Y, Belonging to INT5 Genotype
    Lee H, Kim BJ, Kim K, Hong SH, Kook YH
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-36Y, belonging to the INT5 genotype
    Kim BJ, Choi BS, Choi IY, Lee JH, Chun J, Hong SH, Kook YH
    Ref: Journal of Bacteriology, 194:4141, 2012 : PubMed

            

    Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-64, belonging to the INT1 genotype
    Kim BJ, Choi BS, Lim JS, Choi IY, Kook YH
    Ref: Journal of Bacteriology, 194:3268, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer