Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9myco-j5efy3

Mycobacterium colombiense, Mycobacterium intracellulare, Mycobacterium sp., Mycobacterium tuberculosis LppT protein Carboxylesterase, type B

Comment
Other strains: Mycobacterium colombiense CECT 3035 Mycobacterium intracellulare (strains ATCC 13950 / DSM 43223 / JCM 638 / NCTC 13025 / 3600; MOTT-02; MOTT-64) Mycobacterium sp. (MOTT36Y; 852002-51971_SCH5477799-a; E3078; 1465703.0; 1482292.6; 1245801.1; 1245852.3; 1165178.9; 852002-40037_SCH5390672); Mycobacterium tuberculosis TKK-01-0051; Mycobacterium sp.; Mycobacterium mantenii; Mycobacterium vulneris


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Mycobacterium colombiense CECT 3035
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium avium complex (MAC): N E > Mycobacterium colombiense: N E > Mycobacterium colombiense CECT 3035: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 15 more: CP003322, CP003323, CP003324
>3 UniProt links 1 more: H8IK00, I2ADH2, J5EFY3
>3 UniProt links 13 more: H8IK00, I2ADH2, J5EFY3
>3 Interpro links 13 more: H8IK00, I2ADH2, J5EFY3
>3 Prodom links 13 more: H8IK00, I2ADH2, J5EFY3
>3 Pfam links 13 more: H8IK00, I2ADH2, J5EFY3
>3 PIRSF links 13 more: H8IK00, I2ADH2, J5EFY3
>3 SUPERFAM links 13 more: H8IK00, I2ADH2, J5EFY3
Sequence
Graphical view for this peptide sequence: 9myco-j5efy3
Colored MSA for Carb_B_Bacteria (raw)
MHQRTVRAHTAIGTVEGFTRDGVTRWRSIPYARPPVGNLRFRAPQPAQPW
SGVRHCHGFGNCAPQQRRYTLLGMSGLGGRYQPMSEDCLTLNVVAPEGAA
EGPLPVMVFIHGGGYFLGSSATPLYDGAALARRGCVYVSVNYRLGALGCV
DFSSLSTPEIRIDSNLYLRDLVLALQWIRENIAGFGGDPDNVTIFGESAG
ACITASLLAVPAAKGLFARAISESPASGLVRPKEVAAEFANRFANLLGVR
RQDAANALMQVSAAQLVKTQHQLIDEGMRNRLGAFPIGPVFGDDILPLDP
VEAMRRGEAHRIPLIVGTNAEEGRLFTRFLAMLPTNETMVEELLAEAEPA
IRERITAAYPDYPQRAACIQLGGDFAFASAAWQIAEAHGAHAPTYLYRYD
YAPRTLRWSGFGATHATELLAVFDVYRTRFGALLTAAADRRAALRVSNQV
QRRWRAFSRTGVPGEDWPAYTADDRAVMVFDRKSRVEFDPHPHRRMAWDG
FSLAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHQRTVRAHTAIGTVEGFTRDGVTRWRSIPYARPPVGNLRFRAPQPAQPW
SGVRHCHGFGNCAPQQRRYTLLGMSGLGGRYQPMSEDCLTLNVVAPEGAA
EGPLPVMVFIHGGGYFLGSSATPLYDGAALARRGCVYVSVNYRLGALGCV
DFSSLSTPEIRIDSNLYLRDLVLALQWIRENIAGFGGDPDNVTIFGESAG
ACITASLLAVPAAKGLFARAISESPASGLVRPKEVAAEFANRFANLLGVR
RQDAANALMQVSAAQLVKTQHQLIDEGMRNRLGAFPIGPVFGDDILPLDP
VEAMRRGEAHRIPLIVGTNAEEGRLFTRFLAMLPTNETMVEELLAEAEPA
IRERITAAYPDYPQRAACIQLGGDFAFASAAWQIAEAHGAHAPTYLYRYD
YAPRTLRWSGFGATHATELLAVFDVYRTRFGALLTAAADRRAALRVSNQV
QRRWRAFSRTGVPGEDWPAYTADDRAVMVFDRKSRVEFDPHPHRRMAWDG
FSLAR


References
    Title: Complete genome sequence of Mycobacterium intracellulare strain ATCC 13950(T)
    Kim BJ, Choi BS, Lim JS, Choi IY, Lee JH, Chun J, Kook YH
    Ref: Journal of Bacteriology, 194:2750, 2012 : PubMed

            

    Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-36Y, belonging to the INT5 genotype
    Kim BJ, Choi BS, Choi IY, Lee JH, Chun J, Hong SH, Kook YH
    Ref: Journal of Bacteriology, 194:4141, 2012 : PubMed

            

    Title: Genome sequence of the Mycobacterium colombiense type strain, CECT 3035
    Gonzalez-Perez M, Murcia MI, Landsman D, Jordan IK, Marino-Ramirez L
    Ref: Journal of Bacteriology, 193:5866, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer