Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9noca-g0w2h6

Rhodococcus sp. CR-53 lipR

Relationship
Family|Fungal-Bact_LIP
Block| X
Position in NCBI Life Tree|Rhodococcus sp. CR-53
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Nocardiaceae: N E > Rhodococcus: N E > Rhodococcus sp. CR-53: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CCC86601
1 UniProt : G0W2H6
1 UniProt : G0W2H6
1 Interpro : G0W2H6
1 Prodom : G0W2H6
1 Pfam : G0W2H6
1 PIRSF : G0W2H6
1 SUPERFAM : G0W2H6
Sequence
Graphical view for this peptide sequence: 9noca-g0w2h6
Colored MSA for Fungal-Bact_LIP (raw)
MASKILFQGAVALTAIALTGITAPTVAAQPSGDSFYQYDGSAPLSSYQPG
AVLKTRTLPYHVVNIPTPLQAVQVLYRSTDALGRPSANVTSILRPPNAQP
DKVVSFQSAYDSLNPEDGPSRAIAGNTPIGSLTASGRNVAFGGTLASGEA
VMFGPLLALGYTVVIPDTEGPNADFAAGPEYGMMTLDSLRAARNTPETGI
SDSAEIGLMGYSGGAIATNWASILAPDYAPDINEDLIGAAQGGLLVNPAN
NLRYANGSIGWAGVVGMAVVGLARAYDIDFDPYLGDRGRELLPRIEDASI
GNVILQYPGVTWQDLAKPEYANPNSVPEYVDVANKINMGNAPIPTIPMFI
AQAANGALEGTQPGGPGVGPGDGVMVAGDVRSLATRYCDAGLSIQYDQYD
TISHVPGGALWLPGAITWLNDRFNGSQLPNNCSNIAPGNSLAPEEHAAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASKILFQGAVALTAIALTGITAPTVAAQPSGDSFYQYDGSAPLSSYQPG
AVLKTRTLPYHVVNIPTPLQAVQVLYRSTDALGRPSANVTSILRPPNAQP
DKVVSFQSAYDSLNPEDGPSRAIAGNTPIGSLTASGRNVAFGGTLASGEA
VMFGPLLALGYTVVIPDTEGPNADFAAGPEYGMMTLDSLRAARNTPETGI
SDSAEIGLMGYSGGAIATNWASILAPDYAPDINEDLIGAAQGGLLVNPAN
NLRYANGSIGWAGVVGMAVVGLARAYDIDFDPYLGDRGRELLPRIEDASI
GNVILQYPGVTWQDLAKPEYANPNSVPEYVDVANKINMGNAPIPTIPMFI
AQAANGALEGTQPGGPGVGPGDGVMVAGDVRSLATRYCDAGLSIQYDQYD
TISHVPGGALWLPGAITWLNDRFNGSQLPNNCSNIAPGNSLAPEEHAAG


References
    Title: Rational evolution of the unusual Y-type oxyanion hole of Rhodococcus sp. CR53 lipase LipR
    Infanzon B, Sotelo PH, Martinez J, Diaz P
    Ref: Enzyme Microb Technol, 108:26, 2018 : PubMed

            

    Title: Rhodococcus sp. Strain CR-53 LipR, the First Member of a New Bacterial Lipase Family (Family X) Displaying an Unusual Y-Type Oxyanion Hole, Similar to the Candida antarctica Lipase Clan
    Bassegoda A, Pastor FI, Diaz P
    Ref: Applied Environmental Microbiology, 78:1724, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer