Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9noca-k0eup9

Nocardia brasiliensis ATCC 700358 Haloalkane dehalogenase HLD2 DnbA

Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|Nocardia brasiliensis ATCC 700358
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Nocardiaceae: N E > Nocardia: N E > Nocardia brasiliensis: N E > Nocardia brasiliensis ATCC 700358: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_014982136, AFT99280
1 UniProt : K0EUP9
1 UniProt : K0EUP9
1 Interpro : K0EUP9
1 Pfam : K0EUP9
1 PIRSF : K0EUP9
1 SUPERFAM : K0EUP9
Sequence
Graphical view for this peptide sequence: 9noca-k0eup9
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MATVDVLDSFISYRDAGTGSVPVVFLHGNPTSSYLWRNVIPHVGDQTRTL
APDLIGMGASGKPDIGYRFVEHARYLEAWFDALELDQVVLVGHDWGGALG
LDWAARHPGRVRGVAVLETFLRPLRWSELPPRGAEIFRAYRGPEGERMVL
AENMFIEFNLPNQAPSLTPEDHDVYRAPYPTPESRRPLLAWPRELPLDGE
PADVVAIIENYGRWAATSPEVPKLIMGLANGSGLGSPEAVDWAATTFANA
ETAVIPPAGHHAPEDRPDEIGAAIAAWLRRHTLVGAAEIA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATVDVLDSFISYRDAGTGSVPVVFLHGNPTSSYLWRNVIPHVGDQTRTL
APDLIGMGASGKPDIGYRFVEHARYLEAWFDALELDQVVLVGHDWGGALG
LDWAARHPGRVRGVAVLETFLRPLRWSELPPRGAEIFRAYRGPEGERMVL
AENMFIEFNLPNQAPSLTPEDHDVYRAPYPTPESRRPLLAWPRELPLDGE
PADVVAIIENYGRWAATSPEVPKLIMGLANGSGLGSPEAVDWAATTFANA
ETAVIPPAGHHAPEDRPDEIGAAIAAWLRRHTLVGAAEIA


Reference
    Title: Functional and Mechanistic Characterization of an Enzyme Family Combining Bioinformatics and High-Throughput Microfluidics
    Vasina M, Vanacek P, Hon J, Kovar D, Faldynova H, Kunka A, Badenhorst C, Buryska T, Mazurenko S and Prokop Z <5 more author(s)>
    Ref: ResearchSquare, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer