Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9noca-q06gc0

Rhodococcus sp. NS1 Putative esterase

Relationship
Family|A85-Mycolyl-transferase
Block| X
Position in NCBI Life Tree|Rhodococcus sp. NS1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Nocardiaceae: N E > Rhodococcus: N E > Rhodococcus sp. NS1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DQ888171
1 UniProt : Q06GC0
1 UniProt : Q06GC0
1 Interpro : Q06GC0
1 Prodom : Q06GC0
1 Pfam : Q06GC0
1 PIRSF : Q06GC0
1 SUPERFAM : Q06GC0
Sequence
Graphical view for this peptide sequence: 9noca-q06gc0
Colored MSA for A85-Mycolyl-transferase (raw)
MRGVDVRSRASMGTRRARMLAAAVAAMMLVPLGGGVASAQDRESDPIVAS
QGLLADPVAPNGSRIVSSEIDGQYLTVQVYSAAMDTTIPVRVQRPHDASE
PRPVLYLVNGAGGGTDSATWWANTDVGEFLTGQNVNVVMPLGGAFSYYTD
WKREDPQLGMNKWQTFFLDELPPLIDAALDTNGVQAIAANSMTATAVLQY
AIAKPGFYSAVAGYSGCAQTSDPVGREFVKLVVETWGGGDVRNMYGEDDD
PAWVANDPVVNAEGLRGTRLFISDATGLPGPHDTLGNEFTIGEQDAALDQ
QGLALANQVVVGGVIEAAVHWCTTNLQTRLRELDIPATFDLQPAGTHSWG
YWQDAFHRSWPLLAEELGLPQPQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRGVDVRSRASMGTRRARMLAAAVAAMMLVPLGGGVASAQDRESDPIVAS
QGLLADPVAPNGSRIVSSEIDGQYLTVQVYSAAMDTTIPVRVQRPHDASE
PRPVLYLVNGAGGGTDSATWWANTDVGEFLTGQNVNVVMPLGGAFSYYTD
WKREDPQLGMNKWQTFFLDELPPLIDAALDTNGVQAIAANSMTATAVLQY
AIAKPGFYSAVAGYSGCAQTSDPVGREFVKLVVETWGGGDVRNMYGEDDD
PAWVANDPVVNAEGLRGTRLFISDATGLPGPHDTLGNEFTIGEQDAALDQ
QGLALANQVVVGGVIEAAVHWCTTNLQTRLRELDIPATFDLQPAGTHSWG
YWQDAFHRSWPLLAEELGLPQPQ



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer