Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9plan-a6c5t2

Planctomyces maris DSM 8797 Acetyl esterase (Acetylxylosidase)

Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Planctomyces maris DSM 8797
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Planctomycetes: N E > Planctomycetia: N E > Planctomycetales: N E > Planctomycetaceae: N E > Gimesia: N E > Gimesia maris: N E > Gimesia maris DSM 8797: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ABCE01000012
1 UniProt : A6C5T2
1 UniProt : A6C5T2
1 Interpro : A6C5T2
1 Prodom : A6C5T2
1 Pfam : A6C5T2
1 PIRSF : A6C5T2
1 SUPERFAM : A6C5T2
Sequence
Graphical view for this peptide sequence: 9plan-a6c5t2
Colored MSA for A85-EsteraseD-FGH (raw)
MFSKRFWNNLMKAGLMVGLSLSASELSASELETEELFPRIDAVSFESSRL
KKRKRAVVVLPKNWQSIKPAERRTLVILHGRGRHERSLIDDKLIRQQLLG
SGLFIILPDGDDGWFLNSPLRKQDVYETYLEEVLAIVSEQYELPTSQKQC
AIAGWSMGGFGCVRFAERHPGRFAAVSSIIGLLDFPRSGLPEGQSYKVPV
DRFGSDEAVWKQFNPINDAEKLKGASVLIITADQAFDRTMNEHFRDRLTE
LKLPHEYVELKGGHTFPVVRASIPLVLAHTKRVLQRN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFSKRFWNNLMKAGLMVGLSLSASELSASELETEELFPRIDAVSFESSRL
KKRKRAVVVLPKNWQSIKPAERRTLVILHGRGRHERSLIDDKLIRQQLLG
SGLFIILPDGDDGWFLNSPLRKQDVYETYLEEVLAIVSEQYELPTSQKQC
AIAGWSMGGFGCVRFAERHPGRFAAVSSIIGLLDFPRSGLPEGQSYKVPV
DRFGSDEAVWKQFNPINDAEKLKGASVLIITADQAFDRTMNEHFRDRLTE
LKLPHEYVELKGGHTFPVVRASIPLVLAHTKRVLQRN



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer