Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9prot-a0a1c2fts9

Campylobacter ornithocola Uncharacterized protein

Relationship
Family|BioG_Pimeloyl-ACP-methyl-esterase
Block| X
Position in NCBI Life Tree|Campylobacter ornithocola
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Epsilonproteobacteria: N E > Campylobacterales: N E > Campylobacteraceae: N E > Campylobacter: N E > Campylobacter ornithocola: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_066008256
Sequence
Graphical view for this peptide sequence: 9prot-a0a1c2fts9
Colored MSA for BioG_Pimeloyl-ACP-methyl-esterase (raw)
MKTHFLHENANSSELILFFSGFCSHFSHFAHLKSDVNVLMVYDYTSFGWE
FDLHKFEKITLVGFSMGVCVASKLLKDIKFDKKIAINGTNLPINDEFGIK
KAIFKLTIKRFALEDFKANLLEKRMSLSDEFYFEKNEHLKAELLSLYEFC
TKDLNENFTWDKAIISKEDKIFPPKHAFNFFKKKAVFIDEPHFAFFKYHT
WEALCKLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTHFLHENANSSELILFFSGFCSHFSHFAHLKSDVNVLMVYDYTSFGWE
FDLHKFEKITLVGFSMGVCVASKLLKDIKFDKKIAINGTNLPINDEFGIK
KAIFKLTIKRFALEDFKANLLEKRMSLSDEFYFEKNEHLKAELLSLYEFC
TKDLNENFTWDKAIISKEDKIFPPKHAFNFFKKKAVFIDEPHFAFFKYHT
WEALCKLS



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer