(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > delta/epsilon subdivisions: NE > Epsilonproteobacteria: NE > Campylobacterales: NE > Campylobacteraceae: NE > Arcobacter: NE > Arcobacter sp. L: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MIIYIHGFASSGFGSKPQKFKEYFEEEIITISLPTIPNLAIDTLEQIIEF SLNKEEPVYLVGSSLGGFYALYLANKYDLKAVLINPAVNPWGTLHRYEGV EFVTNYYDNSRFEFTSNHIKSLKNYEVQFIKNPQNFITLLQEEDEVLDFS EAALKLEETDLIIEEGGSHSFDGIERYFRKINSFFYN
Arcobacter butzleri strain ED-1 is an exoelectrogenic epsilonproteobacterium isolated from the anode biofilm of a microbial fuel cell. Arcobacter sp. strain L dominates the liquid phase of the same fuel cell. Here we report the finished and annotated genome sequences of these organisms.