Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9psed-a0a0d6c623

Pseudomonas sp. Esterase/lipase

Comment
Other strains: Pseudomonas sp. (St29; Os17)


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Pseudomonas sp. St29
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas sp. St29: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AP014628, AP014627
1 UniProt : A0A0D6BNQ1
1 UniProt : A0A0D6BNQ1
1 Interpro : A0A0D6BNQ1
1 Prodom : A0A0D6BNQ1
1 Pfam : A0A0D6BNQ1
1 PIRSF : A0A0D6BNQ1
1 SUPERFAM : A0A0D6BNQ1
Sequence
Graphical view for this peptide sequence: 9psed-a0a0d6c623
Colored MSA for CarbLipBact_2 (raw)
MSQAEIDLGEGDAGFVLGTGPVGVLLIHGLTGTPTELRRVAQGLAKDGTC
SVYVPTLPGHCGDNSDLQATGWQDWYEGVRKTFVGVQQRHQEVFVGGLSM
GAVMSMYLASEHPGRISGLLMYSTTLKYDGWSINKLAFLTPLLMKIPFGV
HICRFEEKPPYGIKNERLRAIVEKQMKAGESSNAGLLTMEGVTVRELHRM
NAVVKKRMPSIMTPALVLHSSEDDITSPWNANYVERKLGGPVTKILLDNC
YHMITVDLQYQRVIELSVDFIQQRVTQPAEREDYRQLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSQAEIDLGEGDAGFVLGTGPVGVLLIHGLTGTPTELRRVAQGLAKDGTC
SVYVPTLPGHCGDNSDLQATGWQDWYEGVRKTFVGVQQRHQEVFVGGLSM
GAVMSMYLASEHPGRISGLLMYSTTLKYDGWSINKLAFLTPLLMKIPFGV
HICRFEEKPPYGIKNERLRAIVEKQMKAGESSNAGLLTMEGVTVRELHRM
NAVVKKRMPSIMTPALVLHSSEDDITSPWNANYVERKLGGPVTKILLDNC
YHMITVDLQYQRVIELSVDFIQQRVTQPAEREDYRQLA


Reference
    Title: Rhizoxin analogs contribute to the biocontrol activity of a newly isolated pseudomonas strain
    Takeuchi K, Noda N, Katayose Y, Mukai Y, Numa H, Yamada K, Someya N
    Ref: Mol Plant Microbe Interact, 28:333, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer