Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9psed-q6f3i7

Pseudomonas sp. WO24 dipeptidyl aminopeptidase IV

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Pseudomonas sp. WO24
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Pseudoxanthomonas: N E > Pseudoxanthomonas mexicana: N E


Molecular evidence
Database
No mutation
4 structures (e.g. : 5YP1, 5YP2, 5YP3... more)
No kinetic





No Substrate
2 inhibitors: 5YP2-8YC, Ile-Pro
1 Genbank : AB183425
1 UniProt : Q6F3I7
>3 Structure links 1 more: 5YP1, 5YP4, 5YP3
1 UniProt : Q6F3I7
1 Interpro : Q6F3I7
1 Prodom : Q6F3I7
1 Pfam : Q6F3I7
1 PIRSF : Q6F3I7
1 SUPERFAM : Q6F3I7
Sequence
Graphical view for this peptide sequence: 9psed-q6f3i7
Colored MSA for DPP4N_Peptidase_S9 (raw)
MRLALFALFALMTVATALPAHAEKLTLEAITGSAPLSGPTLTKPQIAPDG
SRVTFLRGKDRDRNRLDLWEYDIASGQTRLLVDSSVVLPGEEVLSDEEKA
RRERQRIAALSGIVDYQWSPDGKALLFPLGGELYFYDLTKSGRDAVRKLT
NGGGFATDPKISPKGGFVSFIRDRNLWAIDLASGKEVQLTRDGSDTIGNG
VAEFVADEEMDRHTGYWWAPDDAAIAFARIDETPVPVQKRYEVYPDRTEV
VEQRYPAAGDHNVRVQLGVIAPKTGARPRWIDLGKDPDIYLARVDWRDPQ
RLTFQRQSRDQKKIELIETTLTNGTQRTLVTETSTTWVPLHNDLRFLKDG
RFLWSSERSGFEHLYVASEDGSTLTALTQGEWVVDSLLAIDEAAGLAYVS
GTRDGATEAHVYAVPLSGGEPRRLTQAPGMHAATFARNASVFVDSWSSDT
TLPQIELFKADGTKLATLLVNDVSDATHPYAKYRAAHQPTAYGTLTAADG
TTPLHYSLIKPAGFDPKKQYPVVVFVYGGPAAQTVTRAWPGRSDSFFNQY
LAQQGYVVFTLDNRGTPRRGAAFGGALYGKQGTVEVDDQLRGIEWLKSQA
FVDPARIGVYGWSNGGYMTLMLLAKHDEAYACGVAGAPVTDWALYDTHYT
ERYMDLPKANEAGYREASVFTHVDGIGAGKLLLIHGMADDNVLFTNSTKL
MSELQKRGTPFELMTYPGAKHGLRGSDLLHRYRLTEDFFARCLKP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLALFALFALMTVATALPAHAEKLTLEAITGSAPLSGPTLTKPQIAPDG
SRVTFLRGKDRDRNRLDLWEYDIASGQTRLLVDSSVVLPGEEVLSDEEKA
RRERQRIAALSGIVDYQWSPDGKALLFPLGGELYFYDLTKSGRDAVRKLT
NGGGFATDPKISPKGGFVSFIRDRNLWAIDLASGKEVQLTRDGSDTIGNG
VAEFVADEEMDRHTGYWWAPDDAAIAFARIDETPVPVQKRYEVYPDRTEV
VEQRYPAAGDHNVRVQLGVIAPKTGARPRWIDLGKDPDIYLARVDWRDPQ
RLTFQRQSRDQKKIELIETTLTNGTQRTLVTETSTTWVPLHNDLRFLKDG
RFLWSSERSGFEHLYVASEDGSTLTALTQGEWVVDSLLAIDEAAGLAYVS
GTRDGATEAHVYAVPLSGGEPRRLTQAPGMHAATFARNASVFVDSWSSDT
TLPQIELFKADGTKLATLLVNDVSDATHPYAKYRAAHQPTAYGTLTAADG
TTPLHYSLIKPAGFDPKKQYPVVVFVYGGPAAQTVTRAWPGRSDSFFNQY
LAQQGYVVFTLDNRGTPRRGAAFGGALYGKQGTVEVDDQLRGIEWLKSQA
FVDPARIGVYGWSNGGYMTLMLLAKHDEAYACGVAGAPVTDWALYDTHYT
ERYMDLPKANEAGYREASVFTHVDGIGAGKLLLIHGMADDNVLFTNSTKL
MSELQKRGTPFELMTYPGAKHGLRGSDLLHRYRLTEDFFARCLKP


References
    Title: Crystal structures of a bacterial dipeptidyl peptidase IV reveal a novel substrate recognition mechanism distinct from that of mammalian orthologues
    Roppongi S, Suzuki Y, Tateoka C, Fujimoto M, Morisawa S, Iizuka I, Nakamura A, Honma N, Shida Y and Nonaka T <3 more author(s)>
    Ref: Sci Rep, 8:2714, 2018 : PubMed

            

    Title: Periplasmic form of dipeptidyl aminopeptidase IV from Pseudoxanthomonas mexicana WO24: purification, kinetic characterization, crystallization and X-ray crystallographic analysis
    Roppongi S, Tateoka C, Fujimoto M, Iizuka I, Morisawa S, Nakamura A, Honma N, Suzuki Y, Shida Y and Nonaka T <3 more author(s)>
    Ref: Acta Crystallographica F Struct Biol Commun, 73:601, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer