Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-a0a075v869

Amycolatopsis japonica. Uncharacterized protein

Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Amycolatopsis japonica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Amycolatopsis: N E > Amycolatopsis japonica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP008953
1 UniProt : A0A075V869
1 UniProt : A0A075V869
1 Interpro : A0A075V869
1 Prodom : A0A075V869
1 Pfam : A0A075V869
1 PIRSF : A0A075V869
1 SUPERFAM : A0A075V869
Sequence
Graphical view for this peptide sequence: 9pseu-a0a075v869
Colored MSA for Carb_B_Bacteria (raw)
MHLLLAIVTGLLTIVAPVDPLVVRTDAGPVRGMDSGPTRTFDGIRFAAPP
VGEDRWKPPRPPEPWKEVADATKPGAACTQLMPGSAEDCLFLNVTVPRDA
GNRRLPVLVWLHGGGYTMDAGSLYGARRLADQGDVVVVTTNYRLGVFGYF
GLPGLAGSGDFGFMDQLSALHWTQRNIAAFGGDPRNVTVAGQSSGGMSTC
ALLTSPAAAGLFHKAAIMSGSCLLNWPPGGLIPNQEAQTPYAPLAKTEAD
GAAVAASHGCEGPDTLDCLRRLPAADLLKDNQTFANHLTYGTPLLPLDPA
KALRRGAFHRVPVISGGTHDEMRAFIAGVEKLKPITEERYQELLRKSFGE
YADEVAAEYPSRDHLSPAMAWATVTTDRSWACPTTEGNRLLSRRTSVHAY
EFDDKNAPNVNGNDVPTVPHGAAHALDLVYLFELSGVEESLDAAQQRLSR
QMIAYWTTFMRTGDPNAPGSPRWDSDAVLSLAPDAIRPVAHDVDHRCGFW
AGLRS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHLLLAIVTGLLTIVAPVDPLVVRTDAGPVRGMDSGPTRTFDGIRFAAPP
VGEDRWKPPRPPEPWKEVADATKPGAACTQLMPGSAEDCLFLNVTVPRDA
GNRRLPVLVWLHGGGYTMDAGSLYGARRLADQGDVVVVTTNYRLGVFGYF
GLPGLAGSGDFGFMDQLSALHWTQRNIAAFGGDPRNVTVAGQSSGGMSTC
ALLTSPAAAGLFHKAAIMSGSCLLNWPPGGLIPNQEAQTPYAPLAKTEAD
GAAVAASHGCEGPDTLDCLRRLPAADLLKDNQTFANHLTYGTPLLPLDPA
KALRRGAFHRVPVISGGTHDEMRAFIAGVEKLKPITEERYQELLRKSFGE
YADEVAAEYPSRDHLSPAMAWATVTTDRSWACPTTEGNRLLSRRTSVHAY
EFDDKNAPNVNGNDVPTVPHGAAHALDLVYLFELSGVEESLDAAQQRLSR
QMIAYWTTFMRTGDPNAPGSPRWDSDAVLSLAPDAIRPVAHDVDHRCGFW
AGLRS


Reference
    Title: Complete genome sequence of the actinobacterium Amycolatopsis japonica MG417-CF17(T) (=DSM 44213T) producing (S,S)-N,N'-ethylenediaminedisuccinic acid
    Stegmann E, Albersmeier A, Spohn M, Gert H, Weber T, Wohlleben W, Kalinowski J, Ruckert C
    Ref: J Biotechnol, 189:46, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer