Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-a0a0m8yj61

Saccharothrix sp.. Poly(3-hydroxybutyrate) depolymerase

Comment
n-term Ricin B lectin excluded. Other strains: Saccharothrix sp. (NRRL B-16348; ALI-22-I)


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Saccharothrix sp. NRRL B-16348
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Saccharothrix: N E > Saccharothrix sp. NRRL B-16348: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9pseu-a0a0m8yj61
Colored MSA for FaeC (raw)
MFGAAAALLLAGTDVAGAEPAPAAPVTSDTVTTAAATPGCGKAPTLRSGT
HTIQTGGKNRSFILSIPDNYNNTYQHRLVFGFHWLGGTMDQVAGGGSDGA
VYAHYGLKQLSNNTAIFVAPQGLNNGWGNSGGEDVNFVDAMIKRIEDDLC
VDTTQRFSLGFSYGGAMSISLACSRPTVFRAIAAIASPGEISGCSGGTAP
VAYMGIHGISDNIGSGRGQRDRWVRNNGCTVQNPPEPARGSNTHITTAYS
GCRTGYPVVWAPFDGGHQQGPVDGCAGCESGARSWVKGEVWKFFT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFGAAAALLLAGTDVAGAEPAPAAPVTSDTVTTAAATPGCGKAPTLRSGT
HTIQTGGKNRSFILSIPDNYNNTYQHRLVFGFHWLGGTMDQVAGGGSDGA
VYAHYGLKQLSNNTAIFVAPQGLNNGWGNSGGEDVNFVDAMIKRIEDDLC
VDTTQRFSLGFSYGGAMSISLACSRPTVFRAIAAIASPGEISGCSGGTAP
VAYMGIHGISDNIGSGRGQRDRWVRNNGCTVQNPPEPARGSNTHITTAYS
GCRTGYPVVWAPFDGGHQQGPVDGCAGCESGARSWVKGEVWKFFT


Reference
    Title: Polysaccharide Degradation Capability of Actinomycetales Soil Isolates from a Semiarid Grassland of the Colorado Plateau
    Yeager CM, Gallegos-Graves V, Dunbar J, Hesse CN, Daligault H, Kuske CR
    Ref: Applied Environmental Microbiology, 83:e03020, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer