Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-a0a1q9rvu8

Pseudonocardia sp. CNS-004. Acetylxylan esterase

Relationship
Family|Xaa-Pro-like_dom
Block| X
Position in NCBI Life Tree|Pseudonocardia sp. CNS-004
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Pseudonocardia: N E > Pseudonocardia sp. CNS-004: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : MKJV01000112, WP_075954488
1 UniProt : A0A1Q9RVU8
1 UniProt : A0A1Q9RVU8
1 Interpro : A0A1Q9RVU8
1 Prodom : A0A1Q9RVU8
1 Pfam : A0A1Q9RVU8
1 PIRSF : A0A1Q9RVU8
1 SUPERFAM : A0A1Q9RVU8
Sequence
Graphical view for this peptide sequence: 9pseu-a0a1q9rvu8
Colored MSA for Xaa-Pro-like_dom (raw)
MVRSEIAFDAEGVTLRGWFYPAEDTSGRRPTVVMAHGFSAVKEMYLDAFA
EVFAAAGLNALVFDNRSFGASDGEPRQEIDPWQQVRDYRHAITYAGTLDD
VDSTRIGVWGSSYSGGHVLVLGAIDRRVKAVVSQVPLVSGSANVAELVRA
DFRAGFREQFDADRAARFAGDPPAMVPVVAEDPLAPSALPMPDSWTWFIE
TGKTRAPAWRNEVTLRSVEMLGEYEPGTYIGRITPTPLLMIVAREDHLTP
AHLAIDAYEHARQPKELVILPGGHFDAYNSGFDGASGPARDWFVEHLARG
A
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVRSEIAFDAEGVTLRGWFYPAEDTSGRRPTVVMAHGFSAVKEMYLDAFA
EVFAAAGLNALVFDNRSFGASDGEPRQEIDPWQQVRDYRHAITYAGTLDD
VDSTRIGVWGSSYSGGHVLVLGAIDRRVKAVVSQVPLVSGSANVAELVRA
DFRAGFREQFDADRAARFAGDPPAMVPVVAEDPLAPSALPMPDSWTWFIE
TGKTRAPAWRNEVTLRSVEMLGEYEPGTYIGRITPTPLLMIVAREDHLTP
AHLAIDAYEHARQPKELVILPGGHFDAYNSGFDGASGPARDWFVEHLARG
A


Reference
    Title: Sequencing rare marine actinomycete genomes reveals high density of unique natural product biosynthetic gene clusters
    Schorn MA, Alanjary MM, Aguinaldo K, Korobeynikov A, Podell S, Patin N, Lincecum T, Jensen PR, Ziemert N, Moore BS
    Ref: Microbiology, 162:2075, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer