Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-h0k1d7

Saccharomonospora azurea. 3-oxoadipate enol-lactonase

Comment
Other strains: Saccharomonospora azurea (SZMC 14600; NA-128)


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Saccharomonospora azurea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Saccharomonospora: N E > Saccharomonospora azurea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AHBX01000055, CM001466
2 UniProt : H0K1D7, H8G517
2 UniProt : H0K1D7, H8G517
2 Interpro : H0K1D7, H8G517
2 Prodom : H0K1D7, H8G517
2 Pfam : H0K1D7, H8G517
2 PIRSF : H0K1D7, H8G517
2 SUPERFAM : H0K1D7, H8G517
Sequence
Graphical view for this peptide sequence: 9pseu-h0k1d7
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MTPHHQITGPDTGEVVVLAGSIGSNLSMWDPQVPRLVDAGFRVVRFDNRG
HGRSPVPEGPSSMADLAGDVVELLDTLGIERAHLVGLSLGGMIGMWLGAH
EPSRIDRLVLCCTSAKLGTPQMWEERATQAKTKGMVSIADGSIGRWFTPG
WIQANPGLAKEYHHMTATVPAAGYASCCAAIGGMDLRDALPSITAPTLVI
GGRDDQATPPEHAQLIADRIPGARLELVDGAAHLGNVEQPEIFGELITEH
LTAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTPHHQITGPDTGEVVVLAGSIGSNLSMWDPQVPRLVDAGFRVVRFDNRG
HGRSPVPEGPSSMADLAGDVVELLDTLGIERAHLVGLSLGGMIGMWLGAH
EPSRIDRLVLCCTSAKLGTPQMWEERATQAKTKGMVSIADGSIGRWFTPG
WIQANPGLAKEYHHMTATVPAAGYASCCAAIGGMDLRDALPSITAPTLVI
GGRDDQATPPEHAQLIADRIPGARLELVDGAAHLGNVEQPEIFGELITEH
LTAR


Reference
    Title: Genome sequence of the soil bacterium Saccharomonospora azurea type strain (NA-128(T))
    Klenk HP, Held B, Lucas S, Lapidus A, Copeland A, Hammon N, Pitluck S, Goodwin LA, Han C and Woyke T <9 more author(s)>
    Ref: Stand Genomic Sci, 6:220, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer