Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-q6jhn6

Saccharopolyspora spinosa obsc

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Saccharopolyspora spinosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Saccharopolyspora: N E > Saccharopolyspora spinosa: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY466441
1 UniProt : Q6JHN6
1 UniProt : Q6JHN6
1 Interpro : Q6JHN6
1 Prodom : Q6JHN6
1 Pfam : Q6JHN6
1 PIRSF : Q6JHN6
1 SUPERFAM : Q6JHN6
Sequence
Graphical view for this peptide sequence: 9pseu-q6jhn6
Colored MSA for Thioesterase (raw)
IEPGNALQELGFDSLTSVELRNRLNLATGLTLLPTLAFDHPTIGELAAHL
ATELAESAGAAPAAEVTALVEDGAPDIVSSLYREAHDAGQFRLASELLMS
VARLRPTFSDAAELERKPKPVRLVGGDSGTHLVCFTPIVPLTGANLYYPL
AAALPGGLTVSALASPGFVEGEKLPVDASVLVSLQAETVAEHVGEAPFVL
AGLSSGGIVAHTTAKRLADCGKPPRAVILFDTYAMHDVSVLETGPHFMTA
MFERAAGVVPIDSTRLSAYEWTCGLFGHWDPEPMPVPTLLIRASEPMSPD
LTGKNWRTNLDGVSTIVDVPGNHYSLMEEFAASTAQVVHDWLRTLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IEPGNALQELGFDSLTSVELRNRLNLATGLTLLPTLAFDHPTIGELAAHL
ATELAESAGAAPAAEVTALVEDGAPDIVSSLYREAHDAGQFRLASELLMS
VARLRPTFSDAAELERKPKPVRLVGGDSGTHLVCFTPIVPLTGANLYYPL
AAALPGGLTVSALASPGFVEGEKLPVDASVLVSLQAETVAEHVGEAPFVL
AGLSSGGIVAHTTAKRLADCGKPPRAVILFDTYAMHDVSVLETGPHFMTA
MFERAAGVVPIDSTRLSAYEWTCGLFGHWDPEPMPVPTLLIRASEPMSPD
LTGKNWRTNLDGVSTIVDVPGNHYSLMEEFAASTAQVVHDWLRTLD


Reference
    Title: Analysis of a 108-kb region of the Saccharopolyspora spinosa genome covering the obscurin polyketide synthase locus
    Zirkle R, Black TA, Gorlach J, Ligon JM, Molnar I
    Ref: DNA Sequence, 15:123, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer