Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9rhiz-a0a0s2en26

Aureimonas sp. AU20. Uncharacterized protein

Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Aureimonas sp. AU20
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Aurantimonadaceae: N E > Aureimonas: N E > Aureimonas sp. AU20: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP006367, WP_061975113
1 UniProt : A0A0S2EN26
1 UniProt : A0A0S2EN26
1 Interpro : A0A0S2EN26
1 Pfam : A0A0S2EN26
1 PIRSF : A0A0S2EN26
1 SUPERFAM : A0A0S2EN26
Sequence
Graphical view for this peptide sequence: 9rhiz-a0a0s2en26
Colored MSA for VirJ (raw)
MKRAPLLLAALLTPILLGGVGAGVLLSRVKSNAAAAVPAAVVTYENMAGV
PVFEPDSDPVGLTVLLSDEGGIAREDRELAAKLVDGGQIVVQIDLVRWRA
ALEEGIEDGDDCIYLGSDIEGIAKEALRALELQTYFHPVVVGRGVGGTVA
YAAVADTPAATMAGGVALNAAPSARSTLPVCAGAKATPAGRGGFAYDRTA
DLIQPFVFIEPEGHSTDLAPTAPYKAATVVAKDPATALDAVVAAADNISQ
ADNSALPIIVTKPKGEPIAVALFFSGDGGWRDLDKTIGDWLSEHGVEVIG
VDALRYFWSEKTPEQMATDMETMLGKANPKPGVPVALLGYSFGADTLPFA
YPKLPQIWTDRIDLIGLLAPSQKTGFEISVGGWLGMSTGASDVVNALKAV
PVSKLLCIYGTEDEADTACLAPQLADAAKLSIEGGHHFDGNYEALAERLL
NAIKSGPAAALAAPTEAAAATPATPAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRAPLLLAALLTPILLGGVGAGVLLSRVKSNAAAAVPAAVVTYENMAGV
PVFEPDSDPVGLTVLLSDEGGIAREDRELAAKLVDGGQIVVQIDLVRWRA
ALEEGIEDGDDCIYLGSDIEGIAKEALRALELQTYFHPVVVGRGVGGTVA
YAAVADTPAATMAGGVALNAAPSARSTLPVCAGAKATPAGRGGFAYDRTA
DLIQPFVFIEPEGHSTDLAPTAPYKAATVVAKDPATALDAVVAAADNISQ
ADNSALPIIVTKPKGEPIAVALFFSGDGGWRDLDKTIGDWLSEHGVEVIG
VDALRYFWSEKTPEQMATDMETMLGKANPKPGVPVALLGYSFGADTLPFA
YPKLPQIWTDRIDLIGLLAPSQKTGFEISVGGWLGMSTGASDVVNALKAV
PVSKLLCIYGTEDEADTACLAPQLADAAKLSIEGGHHFDGNYEALAERLL
NAIKSGPAAALAAPTEAAAATPATPAR


Reference
    Title: Bacterial clade with the ribosomal RNA operon on a small plasmid rather than the chromosome
    Anda M, Ohtsubo Y, Okubo T, Sugawara M, Nagata Y, Tsuda M, Minamisawa K, Mitsui H
    Ref: Proc Natl Acad Sci U S A, 112:14343, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer