(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Alphaproteobacteria: NE > Rhizobiales: NE > Aurantimonadaceae: NE > Aureimonas: NE > Aureimonas sp. AU20: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MPEVIFNGPAGRLEGRYQAAKEKNAPIALVLHPHPRFGGTMNNQIVYQLF YMFVERGFTTLRFNFRGIGRSQGEFDHGSGELSDAAAALDWIQAIHPDSK NCWVAGYSFGSWIGMQLLMRRPEIEGFMSIAPQPNSYDFSFLAPCPSSGL IIHGDKDKVAPPKDVQGLVDKLKTQKGILITQKTIEGANHFFTDHTPELM AECAEYLDRRLIGELSDVRPKRLK
rRNA is essential for life because of its functional importance in protein synthesis. The rRNA (rrn) operon encoding 16S, 23S, and 5S rRNAs is located on the "main" chromosome in all bacteria documented to date and is frequently used as a marker of chromosomes. Here, our genome analysis of a plant-associated alphaproteobacterium, Aureimonas sp. AU20, indicates that this strain has its sole rrn operon on a small (9.4 kb), high-copy-number replicon. We designated this unusual replicon carrying the rrn operon on the background of an rrn-lacking chromosome (RLC) as the rrn-plasmid. Four of 12 strains close to AU20 also had this RLC/rrn-plasmid organization. Phylogenetic analysis showed that those strains having the RLC/rrn-plasmid organization represented one clade within the genus Aureimonas. Our finding introduces a previously unaddressed viewpoint into studies of genetics, genomics, and evolution in microbiology and biology in general.