Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9rhiz-d2j2t6

Ochrobactrum sp. T63 AidH acyl homoserine lactonase

Relationship
Family|AHL-acylase
Block| X
Position in NCBI Life Tree|Ochrobactrum sp. T63
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Ochrobactrum: N E > Ochrobactrum sp. T63: N E


Molecular evidence
Database
No mutation
6 structures (e.g. : 4G5X, 4G8B, 4G8C... more)
No kinetic





1 substrate:
C6-HSL
2 inhibitors: N-Hexanoyl-L-Homoserine, N-butanoyl-L-homoserine
1 Genbank : GQ849010
1 UniProt : D2J2T6
>3 Structure links 3 more: 4G5X, 4G8B, 4G8C
1 UniProt : D2J2T6
1 Interpro : D2J2T6
1 Prodom : D2J2T6
1 Pfam : D2J2T6
1 PIRSF : D2J2T6
1 SUPERFAM : D2J2T6
Sequence
Graphical view for this peptide sequence: 9rhiz-d2j2t6
Colored MSA for AHL-acylase (raw)
MTINYHELETSHGRIAVRESEGEGAPLLMIHGNSSSGAIFAPQLEGEIGK
KWRVIAPDLPGHGKSTDAIDPDRSYSMEGYADAMTEVMQQLGIADAVVFG
WSLGGHIGIEMIARYPEMRGLMITGTPPVAREEVGQGFKSGPDMALAGQE
IFSERDVESYARSTCGEPFEASLLDIVARTDGRARRIMFEKFGSGTGGNQ
RDIVAEAQLPIAVVNGRDEPFVELDFVSKVKFGNLWEGKTHVIDNAGHAP
FREAPAEFDAYLARFIRDCTQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTINYHELETSHGRIAVRESEGEGAPLLMIHGNSSSGAIFAPQLEGEIGK
KWRVIAPDLPGHGKSTDAIDPDRSYSMEGYADAMTEVMQQLGIADAVVFG
WSLGGHIGIEMIARYPEMRGLMITGTPPVAREEVGQGFKSGPDMALAGQE
IFSERDVESYARSTCGEPFEASLLDIVARTDGRARRIMFEKFGSGTGGNQ
RDIVAEAQLPIAVVNGRDEPFVELDFVSKVKFGNLWEGKTHVIDNAGHAP
FREAPAEFDAYLARFIRDCTQ


References
    Title: High-resolution structures of AidH complexes provide insights into a novel catalytic mechanism for N-acyl homoserine lactonase
    Gao A, Mei GY, Liu S, Wang P, Tang Q, Liu YP, Wen H, An XM, Zhang LQ and Liang DC <1 more author(s)>
    Ref: Acta Crystallographica D Biol Crystallogr, 69:82, 2013 : PubMed

            

    Title: AidH, an alpha/beta-hydrolase fold family member from an Ochrobactrum sp. strain, is a novel N-acylhomoserine lactonase
    Mei GY, Yan XX, Turak A, Luo ZQ, Zhang LQ
    Ref: Applied Environmental Microbiology, 76:4933, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer