Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9rhob-a0a126uwz8

Halocynthiibacter arcticus (Falsihalocynthiibacter arcticus) Cold-Active Esterase (HaEst1)

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Halocynthiibacter arcticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodobacterales: N E > Rhodobacteraceae: N E > Halocynthiibacter: N E > Halocynthiibacter arcticus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
4-methylumbelliferyl-acetate
No inhibitor
2 Genbank : WP_039000957, AML49959
1 UniProt : A0A126UWZ8
1 UniProt : A0A126UWZ8
1 Interpro : A0A126UWZ8
1 Prodom : A0A126UWZ8
1 Pfam : A0A126UWZ8
1 PIRSF : A0A126UWZ8
1 SUPERFAM : A0A126UWZ8
Sequence
Graphical view for this peptide sequence: 9rhob-a0a126uwz8
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MTDPQFLTTETGRKIAYHLTEGKGPGVVFLGGFMSDMGGTKAVYLEEWAK
KTGRAFLRFDYSGHGESSGVFTNGCIGEWAADAQAAISTLTEGPQILVGS
SMGGWMALLVARAMPEKVAGLVGIAAAPDFTEDSMWGGFDAVQKVEMAET
GRVALPSEYGDGPYIITRKLIEDGRENLVLRSPLSLPFPTRFLQGTADAD
VDTSVAMRLLEHVEGGDVRLTLVKGADHRFSTPECLNLITKTCEKVIARA
KF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDPQFLTTETGRKIAYHLTEGKGPGVVFLGGFMSDMGGTKAVYLEEWAK
KTGRAFLRFDYSGHGESSGVFTNGCIGEWAADAQAAISTLTEGPQILVGS
SMGGWMALLVARAMPEKVAGLVGIAAAPDFTEDSMWGGFDAVQKVEMAET
GRVALPSEYGDGPYIITRKLIEDGRENLVLRSPLSLPFPTRFLQGTADAD
VDTSVAMRLLEHVEGGDVRLTLVKGADHRFSTPECLNLITKTCEKVIARA
KF


Reference
    Title: Purification and Crystallographic Analysis of a Novel Cold-Active Esterase (HaEst1) from Halocynthiibacter arcticus
    Jeon S, Hwang J, Yoo W, Chang JW, Do H, Kim HW, Kim KK, Lee JH, Kim TD
    Ref: Crystals, 11:170, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer