Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9rhob-b7rn42

Roseobacter sp. GAI101 Esterase EstC, putative

Relationship
Family|HNLyase_Bact
Block| X
Position in NCBI Life Tree|Roseobacter sp. GAI101
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodobacterales: N E > Rhodobacteraceae: N E > Roseobacter: N E > Roseobacter sp. GAI101: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DS999213
1 UniProt : B7RN42
1 UniProt : B7RN42
1 Interpro : B7RN42
1 Pfam : B7RN42
1 PIRSF : B7RN42
1 SUPERFAM : B7RN42
Sequence
Graphical view for this peptide sequence: 9rhob-b7rn42
Colored MSA for HNLyase_Bact (raw)
MSDILLVHGSCHGAWCWRDLIPALVALGHSPRAIDLPSHGADQTPVNDVT
LDSYADAVLAASTPETVVLGHSMGGFAISAAAQKDPDAMAQLIYLCAYVP
APGLSLADMRKQAPSQPLMPAVRLREDGKSFTLDPTMTEGLFYNDCPDGV
AAFANPQLCAQAVAPTTAALPDTARADAKRRSYIRCMDDRTIPPAYQVTM
TKDWPSADVYEMSTGHSPFFADPKGLAQIIDTILKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDILLVHGSCHGAWCWRDLIPALVALGHSPRAIDLPSHGADQTPVNDVT
LDSYADAVLAASTPETVVLGHSMGGFAISAAAQKDPDAMAQLIYLCAYVP
APGLSLADMRKQAPSQPLMPAVRLREDGKSFTLDPTMTEGLFYNDCPDGV
AAFANPQLCAQAVAPTTAALPDTARADAKRRSYIRCMDDRTIPPAYQVTM
TKDWPSADVYEMSTGHSPFFADPKGLAQIIDTILKR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer