Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9rosi-a0a5c7hxy4

Acer yangbiense. Uncharacterized protein

Relationship
Family|Plant_lipase_EDS1-like
Block| L
Position in NCBI Life Tree|Acer yangbiense
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Sapindales: N E > Sapindaceae: N E > Hippocastanoideae: N E > Acereae: N E > Acer: N E > Acer yangbiense: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : VAHF01000005
1 UniProt : A0A5C7HXY4
1 UniProt : A0A5C7HXY4
1 Interpro : A0A5C7HXY4
1 Pfam : A0A5C7HXY4
1 PIRSF : A0A5C7HXY4
1 SUPERFAM : A0A5C7HXY4
Sequence
Graphical view for this peptide sequence: 9rosi-a0a5c7hxy4
Colored MSA for Plant_lipase_EDS1-like (raw)
MASGRLGVVIKVNEELIKKAWSLAMKAHMSPEKPYLVEKSRSSSEVIFSF
PGSWSVNDWFTRSPFGEKKIDLGKFASLKSIGNEDVAIFNEAFLNRFDAI
LSQLQIEVRIAVAEKKRVVFTGHSSGGPIAILAAVWFLQNGVDLNKTMKP
LCITFGSPLVGDRIFNHALSREDWSQYFTHFVMRYDIFPRVPLAPFDSTE
SQLCHILPLLNPKHTVIEQESVEAAAKDLYENVMRNASSVASNAALHLTG
NTNKLLETMSSFVKLSPYRPFGTYVFCTGNGRLVVVRNPDAVLQILFYSS
QMSSGEGLENSVRSVKDHFGYQSEIQSLETKTVTDLDQLEELPLSSNGGG
DAGSSGIDIVLNELGLSTRARLCLRAAAELEKQKSRNQQKINNKKTEILK
ALQILEEYKVRCQAREVSYYDAFKASKGPDDFNANVKRLELAGIWDEIME
MLKKYDLPDGFEGCREWVNLGTRYRYLVEPLDISNYYRHLKNEDTGPYMI
KGRPRRYRYTQKWLEYAEPKPTRPCLESCFWAEVEELIQTSNRRDFEAVQ
AKVSQLGSQVETWIGAGVLGDDIFLENSTFVNWWKSLPQYLTSISISSFS
TRIK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASGRLGVVIKVNEELIKKAWSLAMKAHMSPEKPYLVEKSRSSSEVIFSF
PGSWSVNDWFTRSPFGEKKIDLGKFASLKSIGNEDVAIFNEAFLNRFDAI
LSQLQIEVRIAVAEKKRVVFTGHSSGGPIAILAAVWFLQNGVDLNKTMKP
LCITFGSPLVGDRIFNHALSREDWSQYFTHFVMRYDIFPRVPLAPFDSTE
SQLCHILPLLNPKHTVIEQESVEAAAKDLYENVMRNASSVASNAALHLTG
NTNKLLETMSSFVKLSPYRPFGTYVFCTGNGRLVVVRNPDAVLQILFYSS
QMSSGEGLENSVRSVKDHFGYQSEIQSLETKTVTDLDQLEELPLSSNGGG
DAGSSGIDIVLNELGLSTRARLCLRAAAELEKQKSRNQQKINNKKTEILK
ALQILEEYKVRCQAREVSYYDAFKASKGPDDFNANVKRLELAGIWDEIME
MLKKYDLPDGFEGCREWVNLGTRYRYLVEPLDISNYYRHLKNEDTGPYMI
KGRPRRYRYTQKWLEYAEPKPTRPCLESCFWAEVEELIQTSNRRDFEAVQ
AKVSQLGSQVETWIGAGVLGDDIFLENSTFVNWWKSLPQYLTSISISSFS
TRIK


Reference
    Title: De novo genome assembly of the endangered Acer yangbiense, a plant species with extremely small populations endemic to Yunnan Province, China
    Yang J, Wariss HM, Tao L, Zhang R, Yun Q, Hollingsworth P, Dao Z, Luo G, Guo H and Sun W <1 more author(s)>
    Ref: Gigascience, 8:, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer