Gene_locus Report for: 9sola-d2cky0Nicotiana attenuata Methyl jasmonate esterase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Nicotianoideae: N E > Nicotianeae: N E > Nicotiana: N E > Nicotiana attenuata: N E
Bodyguard : nicat-a0a1j6kph7Nicotiana attenuata (Coyote tobacco, South American tobacco, Common tobacco); Nicotiana sylvestris (Wood tobacco); Nicotiana tabacum Uncharacterized protein, nicat-a0a1j6kss0Nicotiana attenuata (Coyote tobacco, South American tobacco, Common tobacco); Nicotiana sylvestris (Wood tobacco); Nicotiana tabacum Uncharacterized protein. Chlorophyllase_Plant : nicat-a0a1j6ipe1Nicotiana attenuata (Coyote tobacco). Chlorophyllase-2, chloroplastic, nicat-a0a1j6jsp2Nicotiana attenuata (Coyote tobacco). Chlorophyllase-2, chloroplastic, nicat-a0a1j6k589Nicotiana attenuata (Coyote tobacco). Chlorophyllase-2, chloroplastic, nicat-a0a1j6kzj2Nicotiana attenuata (Coyote tobacco). Chlorophyllase-2, chloroplastic. Duf_1350 : nicat-a0a1j6ihc7Nicotiana attenuata (Coyote tobacco) Uncharacterized protein. Plant_carboxylesterase : nicat-a0a1j6j077Nicotiana attenuata (Coyote tobacco). Putative carboxylesterase 17, nicat-a0a314l3r6Nicotiana attenuata (Coyote tobacco). Putative carboxylesterase 12, nicat-a0a1j6kf44Nicotiana attenuata (Coyote tobacco). Putative carboxylesterase 15, nicat-a0a1j6ikv2Nicotiana attenuata (Coyote tobacco). Putative carboxylesterase 6. Triacylglycerol-lipase-OBL1-like : nicat-a0a1j6hte1Nicotiana attenuata (Coyote tobacco). Lipase_3 domain-containing protein, nicat-a0a1j6inz7Nicotiana attenuata (Coyote tobacco). Lipase_3 domain-containing protein, nicat-a0a1j6j979Nicotiana attenuata (Coyote tobacco). Lipase_3 domain-containing protein. UCP031088 : nicat-a0a1j6ili0Nicotiana attenuata (Coyote tobacco). Uncharacterized protein, nicat-a0a1j6jf10Nicotiana attenuata (Coyote tobacco). Uncharacterized protein, nicat-a0a1j6l7s7Nicotiana attenuata (Coyote tobacco). Uncharacterized protein
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9sola-d2cky0
Colored MSA for Hydroxynitrile_lyase (raw)
MEKGKNHHFVLVHGACHGAWCWYKVVTILRAEGHKVSVLDMAASGIHPKR
TEELNSMAEYNEPLIEFLANLPQEERVVLVGHSMGGINISLAMEMFPQKI
CVAVFVTAFMPGPNLDIVAISQQYNQQVESHMDTEFVYSNGQEKGPTSLL
LGPKVLATNFYQLSPAEDLTLATYLVRPVPLFDESSLLKDSTFTNEKYGS
VRRVYVVCDKDNVLKEEQLQRWLIKNNPPDDVEFIHDADRMVMFSKPREL
CSCLLMISRKYH
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MEKGKNHHFVLVHGACHGAWCWYKVVTILRAEGHKVSVLDMAASGIHPKR
TEELNSMAEYNEPLIEFLANLPQEERVVLVGHSMGGINISLAMEMFPQKI
CVAVFVTAFMPGPNLDIVAISQQYNQQVESHMDTEFVYSNGQEKGPTSLL
LGPKVLATNFYQLSPAEDLTLATYLVRPVPLFDESSLLKDSTFTNEKYGS
VRRVYVVCDKDNVLKEEQLQRWLIKNNPPDDVEFIHDADRMVMFSKPREL
CSCLLMISRKYH
|
|
|
|
