Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9sphn-a0a1e4mug8

Novosphingobium sp. SCN 63-17. Uncharacterized protein

Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|Novosphingobium sp. SCN 63-17
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Sphingomonadaceae: N E > Novosphingobium: N E > Novosphingobium sp. SCN 63-17: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : MEGC01000090
Sequence
Graphical view for this peptide sequence: 9sphn-a0a1e4mug8
Colored MSA for Polyesterase-lipase-cutinase (raw)
MAARNLPNIPGSGPYPAIMEVSPSLPNHVIYRPAAMPSAKLGVLVWGNGG
CQEDGASARQHLLEIASHGYVVIAPGRIMSGPTATEKLPEPAPGAPRRLD
SPTKSADVLAGLDWALKENARAGSPLQGHIDPKQTAVAGHSCGGLQALEV
ARDPRIHAVLIHNSGVFADGSNPIAGINVTKALLKDIHTPIIYILGGPGD
IAYPNGTDDYARIEHVPAVLVNLPVGHGGTFYKPYGGAVAQVSVDWLEWQ
LRGDKSAGRTFTGPACRLCVAPGWSIERKHMD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAARNLPNIPGSGPYPAIMEVSPSLPNHVIYRPAAMPSAKLGVLVWGNGG
CQEDGASARQHLLEIASHGYVVIAPGRIMSGPTATEKLPEPAPGAPRRLD
SPTKSADVLAGLDWALKENARAGSPLQGHIDPKQTAVAGHSCGGLQALEV
ARDPRIHAVLIHNSGVFADGSNPIAGINVTKALLKDIHTPIIYILGGPGD
IAYPNGTDDYARIEHVPAVLVNLPVGHGGTFYKPYGGAVAQVSVDWLEWQ
LRGDKSAGRTFTGPACRLCVAPGWSIERKHMD


Reference
    Title: Bioreactor microbial ecosystems for thiocyanate and cyanide degradation unravelled with genome-resolved metagenomics
    Kantor RS, van Zyl AW, van Hille RP, Thomas BC, Harrison ST, Banfield JF
    Ref: Environ Microbiol, 17:4929, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer